Search by BoMiProt ID - Bomi6394


Primary Information

BoMiProt ID Bomi6394
Protein Name Inhibitor of nuclear factor kappa-B kinase subunit beta
Organism Bos taurus
Uniprot IdQ95KV0
Milk FractionWhey
Ref Sequence Id NP_776778.1
Aminoacid Length 756
Molecular Weight 86647
Fasta Sequence https://www.uniprot.org/uniprot/Q95KV0.fasta
Gene Name IKBKB
Gene Id 281854
Protein Existence Status reviewed

Secondary Information

Protein Function Serine kinase that plays an essential role in the NF-kappa-B signaling pathway
PTMs Hydroxylation, Isopeptide bond formation, Phosphorylation, S-nitrosylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q95KV0|IKKB_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Bos taurus OX=9913 GN=IKBKB PE=2 SV=1 MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL EIQIMRRLNHPNVVAARDVPEGMQSLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGS*177LCT S*181FVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE MDIVVSEDLNGAVKFSSSLPHPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPVYGPNGCF KALDDILNLKLLHVLNMVTGTLHTYPVTEDESLQSLKARIRQDTGILEEDQELLQEAGLA LIPDKPAAQCLSDGKLNEGRTLDMDLVFLFDNSRVTYESQVSPQPQPESVSCILQEPKRN LPFFQLRKVWGQVWHSIQALKEDCSRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK AKLDFFKTSIQIDLEKYREQTEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMSEDEKMVVRLQEKRQKELWNLLKI ACSKVRGPVS*670GS*672PDS*675MNASRLS*682HPCQLMS*689QPCTAPDS*697LPEAAEKS*705EDLVAEAHTLCTQLENALQDTMKEQDQS*733LRSLDWS*740WLQSEEEEQQSLERAS
Predicted Disorder Regions 576-585, 665-756
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Ubiquitination on 'Ser-163' may modulate phosphorylation on C-terminal serine residues.