Search by BoMiProt ID - Bomi6337


Primary Information

BoMiProt ID Bomi6337
Protein Name Hydroxyacid-oxoacid transhydrogenase, mitochondrial/Alcohol dehydrogenase iron-containing protein 1
Organism Bos taurus
Uniprot IdA6QP15
Milk FractionWhey
Ref Sequence Id NP_001095357.1
Aminoacid Length 466
Molecular Weight 50343
Fasta Sequence https://www.uniprot.org/uniprot/A6QP15.fasta
Gene Name ADHFE1
Gene Id 507711
Protein Existence Status reviewed

Secondary Information

Protein Function Alcohol dehydrogenase iron containing 1 (ADHFE1) was recently reported to be associated with colorectal cancer (CRC) differentiation.
Biochemical Properties ADHFE1 is related to bacterial γ-hydroxybutyrate dehydrogenase and has a conserved NAD-binding site.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QP15|HOT_BOVIN Hydroxyacid-oxoacid transhydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ADHFE1 PE=2 SV=1 MAAARSRVVHLLRLLQRAACQCPSHSHTYSQAPGLSPSGKTTDYAFEMAVSTIRYGAGVT KEVGMDLQSMGAKNVCLMTDKNLSQLPPVQTVMDSLVKNGINFKVYDHVRVEPTDTSFME AIEFAKKGAFDAFLAVGGGSTIDTCKAANLYSSSPDSDFLDYVNAPIGKGKPVTVPLKPL IAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLIDPLHTLHMPERVVANSGF DVLCHALESYTALPYHMRSPCPSSPITRPAYQGSNPISDIWAVHALRIVAKYLKRAIRNP DDLEARSNMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKDYNVDHPLVPHGLSV VLTSPAVFTFTSQMFPERHLEVAEILGADTRTARRPDAGPVLADTLRKFLFDLDVDDGLA AIGYSKADIPELVKGTLPQERVTKLAPRPQS*451EEDLSALFEASMKLY
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Hypermethylation of the ADHFE1 promoter by alcohol leads to a decrease in ADHFE1 expression and methylation-mediated silencing of ADHFE1 may be induced the progression of CRC cells.
Bibliography 1.Moon JW, Lee SK, Lee YW, Lee JO, Kim N, Lee HJ, Seo JS, Kim J, Kim HS, Park SH. Alcohol induces cell proliferation via hypermethylation of ADHFE1 in colorectal cancer cells. BMC Cancer. 2014 May 28;14:377. doi: 10.1186/1471-2407-14-377. PMID: 24886599; PMCID: PMC4057807. 2.Kardon T, Noel G, Vertommen D, Schaftingen EV: Identification of the gene. 2.Tae CH, Ryu KJ, Kim SH, Kim HC, Chun HK, Min BH, Chang DK, Rhee PL, Kim JJ, Rhee JC, Kim YH. Alcohol dehydrogenase, iron containing, 1 promoter hypermethylation associated with colorectal cancer differentiation. BMC Cancer. 2013 Mar 22;13:142. doi: 10.1186/1471-2407-13-142. PMID: 23517143; PMCID: PMC3618294. encoding hydroxyacid-oxoacid transhydrogenase, an enzyme that metabolizes 4-hydroxybutyrate. FEBS Lett 2006, 580:2347–2350.