Search by BoMiProt ID - Bomi6322


Primary Information

BoMiProt ID Bomi6322
Protein Name Hormone-sensitive lipase/HSL/Monoacylglycerol lipase LIPE/Retinyl ester hydrolase/REH
Organism Bos taurus
Uniprot IdP16386
Milk FractionWhey,MFGM
Ref Sequence Id NP_001073689.1
Aminoacid Length 756
Molecular Weight 82641
Fasta Sequence https://www.uniprot.org/uniprot/P16386.fasta
Gene Name LIPE
Gene Id 286879
Protein Existence Status reviewed

Secondary Information

Protein Function hydrlysis of triacylglycerols and diacylglcerols.
Biochemical Properties molecular mass of approx. 84 kDa, comprises three major domains: a catalytic domain, a regulatory domain encoding several phosphorylation sites and an N-terminal domain involved in protein-protein and protein-lipid interactions.
Significance in milk Essential role in lipomobilization,for dairy cows to balance the energy requirement for milk production in early lactation.
PTMs phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P16386|LIPS_BOVIN Hormone-sensitive lipase OS=Bos taurus OX=9913 GN=LIPE PE=1 SV=2 MDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLTGVFAGIREQALGLEPALGRLLSVAHL FDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALTQ LRALAYYAQRLLTTNQPGRLFFEGDERVIADFLREYVTLHKGCFYGRCLGFQFTPAIRPF LQTISIGLVSFGEHYKRNETGISVTASSLFTDGRFAIDPELRGAEFERIIQNLDVHFWKA FWNITEIQVLSSLANMASTTVRVSRLLSLPPVAFEMPLTSDPELTVTISPPLAHTGPGPV LVRLISYDLREGQDSKELSSFVRSEGPRSLELRLRPQQAPRSRALVVHIHGGGFVAQTSK SHEPYLKSWAQELGAPILSIDYSLAPEAPFPRALEECFYAYCWAVKHCALLGSTGERICL AGDSAGGNLCFTVSLRAAAYGVRVPDGIMAAYPATMLQSTASPSRLLSLMDHLLPLSVLS KCVSTYAGAETEDHPDSDQKALGVMGLVQRDTALLLRDLRLGASSWLNSFLELGGQKSHL KSVSKTEPMRRS*552VS*554EAALTQPEGSLGTDSLKSLKLHDLGLRNSSDTTDTPELSLS*595AETLGPSAPSTINFLLGSEDGSEMSKAPEELNNKDRVRGVGAAFPEGFHPRRCS*649QGAMWMPLYSA PIVKNPSMSPLLAPDSMLQTLPPVHIVACALDPMLDDSVMFARRLRGLGQPVTLRVAEDL PHGFLSLAALCRETRQAAALCVERIRLILNLPGPPV
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs Reversible phosphorylation mediates its activation by lipolytic hormones. phosphorylated at two sites within the polypeptide, with one site(Ser-565) being phosphorylated under basal conditions, and a second site(Ser 563) being phosphorylated under lipolytic stimulation by cAMP-dependent protein kinase.The basal site has the potential to block modification of the regulatory site and thus exert an anti-lipolytic effect on the enzyme.
Bibliography 1.Locher LF, Meyer N, Weber EM, Rehage J, Meyer U, Dänicke S, Huber K. Hormone-sensitive lipase protein expression and extent of phosphorylation in subcutaneous and retroperitoneal adipose tissues in the periparturient dairy cow. J Dairy Sci. 2011 Sep;94(9):4514-23. doi: 10.3168/jds.2011-4145. PMID: 21854923. 2.Yeaman SJ. Hormone-sensitive lipase--new roles for an old enzyme. Biochem J. 2004 Apr 1;379(Pt 1):11-22. doi: 10.1042/BJ20031811. PMID: 14725507; PMCID: PMC1224062.