Search by BoMiProt ID - Bomi6317


Primary Information

BoMiProt ID Bomi6317
Protein Name Homeobox protein PKNOX1/PBX/knotted homeobox 1
Organism Bos taurus
Uniprot IdQ2HJ84
Milk FractionWhey
Ref Sequence Id NP_001039815.1
Aminoacid Length 436
Molecular Weight 47204
Fasta Sequence https://www.uniprot.org/uniprot/Q2HJ84.fasta
Gene Name PKNOX1/PREP1
Gene Id 533382
Protein Existence Status reviewed

Secondary Information

Protein Function PKNOX1 exerts tumor suppressive activity.The C-terminal domain of MEIS1 confers to PKNOX1 an ectopic transactivating function that promotes leukemogenesis by regulating expression of genes involved in chromatin accessibility and cell cycle progression.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2HJ84|PKNX1_BOVIN Homeobox protein PKNOX1 OS=Bos taurus OX=9913 GN=PKNOX1 PE=2 SV=1 MMATQTLSIDSYPDGQQMQVVTELKTEQDPNCS*33EPDVEGVS*41PPPVGSQTPMDADKQAIYR HPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVK AIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAI TGTLSPQGIVVPASALQQGNVTMATVAGGTVYQPVTVVTPQGQVVTQALSPGTIRIQNSQ LQLQLNQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTN LTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSIASGAAQPAAS ELTVSEGAVVTITAPVSMNVDSLQSLSSDGATLAVQQVMMAEQSEDDSVDSTGDGGAALA PGHLGGLVLENSDSLQ
Predicted Disorder Regions 3 disordered segments; (1-55), (79-85), (104-109)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Bisaillon R, Wilhelm BT, Krosl J, Sauvageau G. C-terminal domain of MEIS1 converts PKNOX1 (PREP1) into a HOXA9-collaborating oncoprotein. Blood. 2011 Oct 27;118(17):4682-9. doi: 10.1182/blood-2011-05-354076. Epub 2011 Sep 7. PMID: 21900201.