Search by BoMiProt ID - Bomi6313


Primary Information

BoMiProt ID Bomi6313
Protein Name Homeobox protein Hox-B4
Organism Bos taurus
Uniprot IdQ08DG5
Milk Fractionwhey
Ref Sequence Id NP_001071582.1
Aminoacid Length 251
Molecular Weight 27683
Fasta Sequence https://www.uniprot.org/uniprot/Q08DG5.fasta
Gene Name HOXB4
Gene Id 768240
Protein Existence Status Reviewed

Secondary Information

Protein Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DG5|HXB4_BOVIN Homeobox protein Hox-B4 OS=Bos taurus OX=9913 GN=HOXB4 PE=2 SV=1 MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRSAC TVQRYAACRDPGPPPPQPPPPPPPPPPGLS*90PRAPAQPPSGALLPEPGQRCEAISSSPPPP PCAQNPLHPSPSHSACKEPVVYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKE FHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGTAGSAGGP PGRPNGGPPAL
Predicted Disorder Regions 16-167
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Barba-de la Rosa, A. P., Briones-Cerecero, E., Lugo-Melchor, O., De León-Rodríguez, A., Santos, L., Castelo-Ruelas, J., Valdivia, A., Piña, P., Chagolla-López, A., Hernandez-Cueto, D., Mantilla, A., Lazos-Ochoa, M., Gonzalez-Yebra, B., & Salcedo, M. (2012). Hox B4 as potential marker of non-differentiated cells in human cervical cancer cells. Journal of cancer research and clinical oncology, 138(2), 293–300. https://doi.org/10.1007/s00432-011-1081-2