Search by BoMiProt ID - Bomi6289


Primary Information

BoMiProt ID Bomi6289
Protein Name Histone H2B type 1-N
Organism Bos taurus
Uniprot IdQ32L48
Milk FractionWhey,Casein
Ref Sequence Id NP_001075211.1
Aminoacid Length 126
Molecular Weight 13923
Fasta Sequence https://www.uniprot.org/uniprot/Q32L48.fasta
Gene Name H2BC15
Gene Id 614958
Protein Existence Status Reviewed

Secondary Information

Protein Function Core component of nucleosome.Participate in nucleosome assembly.
PTMs Acetylation, Glycosylation, Hydroxylation, Isopeptide bond formation, Methylation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32L48|H2B1N_BOVIN Histone H2B type 1-N OS=Bos taurus OX=9913 GN=H2BC15 PE=1 SV=3 MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GNMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS*113EGTKAVT KYTSSK
Predicted Disorder Regions 1-43, 47-58, 84-93, 110-126
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Monoubiquitination at Lys-35 (H2BK34Ub) by the MSL1/MSL2 dimer is required for histone H3 'Lys-4' (H3K4me) and 'Lys-79' (H3K79me) methylation and transcription activation at specific gene loci, such as HOXA9 and MEIS1 loci. Similarly, monoubiquitination at Lys-121 (H2BK120Ub) by the RNF20/40 complex gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation.Deubiquitination by USP49 is required for efficient cotranscriptional splicing of a large set of exons.Monoubiquitinated by DTX3L upon encephalomyocarditis virus (EMCV)-mediated infection.Phosphorylation at Ser-37 (H2BS36ph) by AMPK in response to stress promotes transcription.Phosphorylated on Ser-15 (H2BS14ph) by STK4/MST1 during apoptosis; which facilitates apoptotic chromatin condensation. Also phosphorylated on Ser-15 in response to DNA double strand breaks (DSBs), and in correlation with somatic hypermutation and immunoglobulin class-switch recombination. GlcNAcylation at Ser-113 promotes monoubiquitination of Lys-121.GlcNAcylation facilitates the ubl conjugation of serine 112 on histone H2B and is associated with active genes which is associated with cardiac function.
Bibliography 1.Beck HC, Nielsen EC, Matthiesen R, Jensen LH, Sehested M, Finn P, Grauslund M, Hansen AM, Jensen ON. Quantitative proteomic analysis of post-translational modifications of human histones. Mol Cell Proteomics. 2006 Jul;5(7):1314-25. doi: 10.1074/mcp.M600007-MCP200. Epub 2006 Apr 20. PMID: 16627869. 2.Zhang Y, Mao D, Roswit WT, Jin X, Patel AC, Patel DA, Agapov E, Wang Z, Tidwell RM, Atkinson JJ, Huang G, McCarthy R, Yu J, Yun NE, Paessler S, Lawson TG, Omattage NS, Brett TJ, Holtzman MJ. PARP9-DTX3L ubiquitin ligase targets host histone H2BJ and viral 3C protease to enhance interferon signaling and control viral infection. Nat Immunol. 2015 Dec;16(12):1215-27. doi: 10.1038/ni.3279. Epub 2015 Oct 19. PMID: 26479788; PMCID: PMC4653074. 3.Espinosa J. M. (2008). Histone H2B ubiquitination: the cancer connection. Genes & development, 22(20), 2743–2749. https://doi.org/10.1101/gad.1732108