Search by BoMiProt ID - Bomi6280


Primary Information

BoMiProt ID Bomi6280
Protein Name Histone H1.2/CTL-1
Organism Bos taurus
Uniprot IdP02253
Milk FractionWhey,Casein,MFGM
Ref Sequence Id NP_001076894.1
Aminoacid Length 213
Molecular Weight 21356
Fasta Sequence https://www.uniprot.org/uniprot/P02253.fasta
Gene Name H1-2
Gene Id 513971
Protein Existence Status reviewed

Secondary Information

Protein Function binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts also as a regulator of individual gene transcription through chromatin remodeling, nucleosome spacing and DNA methylation.Destabilization of linker histone H1.2 is essential for ATM activation and DNA damage repair
Biochemical Properties The C-terminal domain is required for high-affinity binding to chromatin
PTMs Acetylation, ADP-ribosylation, Citrullination, Hydroxylation, Methylation, Phosphoprotein
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P02253|H12_BOVIN Histone H1.2 OS=Bos taurus OX=9913 GN=H1-2 PE=1 SV=2 MS*2ETAPAAPAAAPPAEKTPVKKKAAKKPAGARRKASGPPVSELITKAVAASKERSGVSLA ALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAATGEAKPKA KKAGAAKPKKAAGAAKKTKKATGAAT*146PKKTAKKTPKKAKKPAAAAVTKKVAKSPKKAKAA KPKKAAKSAAKAVKPKAAKPKVAKPKKAAPKKK
Predicted Disorder Regions Completely predicted disordered protein; (1-213)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs ADP-ribosylated on Ser-188 in response to DNA damage.During chromatin decondensation,Citrullination at Arg-54 (H1R54ci) by PADI4 takes place within the DNA-binding site of H1 and results in its displacement from chromatin.
Bibliography Li, Z., Li, Y., Tang, M. et al. Destabilization of linker histone H1.2 is essential for ATM activation and DNA damage repair. Cell Res 28, 756–770 (2018).