Search by BoMiProt ID - Bomi6253


Primary Information

BoMiProt ID Bomi6253
Protein Name Hexokinase-1/Brain form hexokinase/Hexokinase type I/HK I
Organism Bos taurus
Uniprot IdP27595
Milk FractionWhey
Aminoacid Length 918
Molecular Weight 103064
Fasta Sequence https://www.uniprot.org/uniprot/P27595.fasta
Gene Name HK1
Protein Existence Status reviewed

Secondary Information

Protein Function Catalyzes the phosphorylation of hexoses, such as D-glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate.
Biochemical Properties In mammals there are four HK isozymes, which vary in their tissue distribution and kinetic properties. Each of the types l-3 HK isozymes consists of a single polypeptide chain with a molecular weight of approximately 100 kDa and is inhibited by the product glucose 6-phosphate.Putative ATP- and glucose-binding domains identified in the carboxy-terminal (catalytic) half of bovine Hexokinase.Ser-178 is positioned within the putative core of glucose binding domain which has been found to be catalytically important for binding to glucose.This serine is involved in the formation of hydrogen bond to the 6-(OH) group of glucose.
PTMs phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P27595|HXK1_BOVIN Hexokinase-1 OS=Bos taurus OX=9913 GN=HK1 PE=2 SV=1 MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMNRFKKEMKNGLSRDFNPTAT VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNRPVHMESEVYDTPENIMH GSGSQLFDHVLECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDQAILITWTKRFKARGA EGNYVVKLLDKAIKKRGDYDANIVAVVNDTVGTMIDCGYDDQHCEVGLIIGTGTNACYME ELRQIDFGWGDDGRMCINTEWGDLGDDGSLEDIRKEFDREFRRGSLNPGKQRFEKMVSGR YMEDVVRLVLVKMAKEGLLFEGRITPELLTRGKFNTS*337DVSAIEKDKEGLHNAKEILTRLG VERSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKSTPRLRTTVRVDGSLYKTH PQYSRRFHKTLRRLVPDSDVRFLLSESGTGKGAAMVTAVAYRLAEQHRQIEETLAHFRLS KQTLMEVKKRLRTEMEMGLRKETNSNATVNMLPSFLRSIPDGTEDGDFLALDLGGTNFRV LLVKIRSGKKSTVEMHNKIYRIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAVKRREEFDLDVVAVVNDTVG TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGNQRQMCINMEWGAFGDNGCSDD IRTDFDKVVDEYSLNSGNQRFENMISGIYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA VVEKIRENRGLDRLNVTVGVDGTLYKLHPQFSRIMHQTVKELSPKCNVSFLLSEDGSGKG AALITAVGVRLRGESAIS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Akt has a direct effect at the level of the mitochondrion, which is mediated via phosphorylation of HK-II and results in protection of mitochondria against oxidant or Ca2+-stimulated PT-pore opening. Akt was reported to directly phosphorylate HK2 at T473 and promote mitochondrial translocation of HK2 in cardiomyocytes. it has been reported that Akt similarly phosphorylates HK2 in cancer cells to enhance the efficiency of HK2 catalytic reaction and subsequently promotes glycolysis.Serine phosphorylation on Ser 23 position is important for enzyme localization.
Bibliography 1.Miyamoto S, Murphy AN, Brown JH. Akt mediates mitochondrial protection in cardiomyocytes through phosphorylation of mitochondrial hexokinase-II. Cell Death Differ. 2008 Mar;15(3):521-9. doi: 10.1038/sj.cdd.4402285. Epub 2007 Dec 7. PMID: 18064042. 2.Griffin LD, Gelb BD, Wheeler DA, Davison D, Adams V, McCabe ER. Mammalian hexokinase 1: evolutionary conservation and structure to function analysis. Genomics. 1991 Dec;11(4):1014-24. doi: 10.1016/0888-7543(91)90027-c. PMID: 1783373.