Primary Information |
---|
BoMiProt ID | Bomi6233 |
---|
Protein Name | Heterochromatin protein 1-binding protein 3 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q08DU9 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001068904.1 |
---|
Aminoacid Length | 555 |
---|
Molecular Weight | 61477 |
---|
FASTA Sequence |
Download |
---|
Gene Name | HP1BP3 |
---|
Gene ID | 510194 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | female gonad |
---|
Protein Function | Hp1bp3 was identified as a candidate marker of intrinsic 5-FU resistance and may represent a potential biomarker for patient stratification or a target of clinical importance. |
---|
Biochemical Properties | Tight binding of HP1BP3 protein to linker DNA at the entry/exit site of nucleosomal DNA involves a long N-terminal extension, globular core, and basic C-terminal tail |
---|
PTMs | Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q08DU9|HP1B3_BOVIN Heterochromatin protein 1-binding protein 3 OS=Bos taurus OX=9913 GN=HP1BP3 PE=2 SV=1
MATDTS*6QGELVHPKALPLIVGAQLIHADKLGEKVEDNTMPIRRAVNSTRET*51PPKSKLAEG
VEEKPEPDVSSEESISTVEEQENET*85PPATSSETEQPKGQPENEEKEENKPSEETKKDEKD
QSKEKEKKVKKTIPSWATLSAS*142QLARAQKQTPMAS*155S*156PRPKMDAILTEAIKACFQKSGASV
VAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQVKGKGASGSFVVVQKSRKPPQK
SRNRKNRS*248S*249AVDPEPQVKLEDILPLAFTRLCEPKEASYSLIRKYVSQYYPKLRVDIRPQL
LKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCS
TTALKKYVLENHPGTNSNYQMHLLKKTLQRCEKNGWMEQISGKGFSGTFQLCFPYYPSPG
VLFPKKEPDDSKDEDEDEDEDDS*443S*444EEDS*448EDEEPPPKRRLQKKTPVKSPGKAAAMKQRGSK
LAPKVPAAQRGKTRPLPKKAPPKAKSPAKKARPSPSVIKKPSGSSSKKPAASVRKEVKLP
GKGKSTMKKSFKAKK |
---|
Predicted Disorder Regions | 1-3, 29-181, 218-260, 313-334, 413-555 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | knockdown of Hp1bp3 in the hippocampus by 50%-75% is sufficient to induce cognitive deficits and transcriptional changes reminiscent of those observed in aging and Alzheimer's disease brains. |
---|
Bibliography | 1.Hadac JN, Miller DD, Grimes IC, Clipson L, Newton MA, Schelman WR, Halberg RB. Heterochromatin Protein 1 Binding Protein 3 Expression as a Candidate Marker of Intrinsic 5-Fluorouracil Resistance. Anticancer Res. 2016 Mar;36(3):845-52. PMID: 26976970; PMCID: PMC4876978. 2.Hayashihara K, Uchiyama S, Shimamoto S, Kobayashi S, Tomschik M, Wakamatsu H, No D, Sugahara H, Hori N, Noda M, Ohkubo T, Zlatanova J, Matsunaga S, Fukui K. The middle region of an HP1-binding protein, HP1-BP74, associates with linker DNA at the entry/exit site of nucleosomal DNA. J Biol Chem. 2010;285:6498–6507. 3.Neuner SM, Ding S, Kaczorowski CC. Knockdown of heterochromatin protein 1 binding protein 3 recapitulates phenotypic, cellular, and molecular features of aging. Aging Cell. 2019 Feb;18(1):e12886. doi: 10.1111/acel.12886. Epub 2018 Dec 13. PMID: 30549219; PMCID: PMC6351847. |