Search by BoMiProt ID - Bomi6225


Primary Information

BoMiProt ID Bomi6225
Protein Name Hepatocyte cell adhesion molecule/Protein hepaCAM
Organism Bos taurus
Uniprot IdA4FUY1
Milk FractionWhey
Ref Sequence Id NP_001026929.2
Aminoacid Length 418
Molecular Weight 46057
Fasta Sequence https://www.uniprot.org/uniprot/A4FUY1.fasta
Gene Name HEPACAM
Gene Id 521015
Protein Existence Status reviewed

Secondary Information

Protein Function It associates with connexin 43 and enhances its localization in cellular junctions,Regulates Warburg Effect of Renal Cell Carcinoma via HIF-1α/NF-κB Signaling Pathway.
Biochemical Properties hepaCAM associates with connexin 43, a main component of gap junctions, and enhances connexin 43 localization to the plasma membrane at cellular junctions. HepaCAM also increases the levels of connexin 43, not by enhancing its transcription but by stabilizing connexin 43 protein. 
PTMs Glycosylation at Asn and Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4FUY1|HECAM_BOVIN Hepatocyte cell adhesion molecule OS=Bos taurus OX=9913 GN=HEPACAM PE=2 SV=1 MKREREAPSRAFSALRLAPFVYLLLIQTEPLEGVN*35ITSPVRLIHGTVGKAALLSVQYSST SSDKPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTY EVEISITDDTFTGEKTIN*138LTVDVPISRPQVLVASTTVLELSEAFTLN*167CSHENGTKPSYTW LKDGKPLLN*189DSRMLLSPDQKVLTITRVLMEDDDLYSCVVENPISQGRSPPVKITVYRRSS LYIILSTGGIFLLVTLVTVCACWKPSKKSGKKRKLEKQNS*280MEYMDQSDDRLKPEADTLPR SGEQERKNPMALYILKDKDSPEPEENPASEPRSAAEPGPPGYSVSPAVPGRS*352PGLPIRSA RRYPRSPARSPATGRTHSS*379PPRAPGSPGRSRSASRTLRTAGVHLIREQDEAGPVEISA
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; (241-263)
Additional Comments Overexpression of HepaCAM inhibits bladder cancer cell proliferation and viability through the AKT/FoxO pathway.
Bibliography 1.Wu M, Moh MC, Schwarz H. HepaCAM associates with connexin 43 and enhances its localization in cellular junctions. Sci Rep. 2016 Nov 7;6:36218. doi: 10.1038/srep36218. PMID: 27819278; PMCID: PMC5098153. 2.Fan Y, Ou L, Fan J, Li L, Wu X, Luo C, Gao Y, Niu L. HepaCAM Regulates Warburg Effect of Renal Cell Carcinoma via HIF-1α/NF-κB Signaling Pathway. Urology. 2019 May;127:61-67. doi: 10.1016/j.urology.2018.11.033. Epub 2018 Dec 4. PMID: 30528714. 3.Tang M, Zhao Y, Liu N, Chen E, Quan Z, Wu X, Luo C. Overexpression of HepaCAM inhibits bladder cancer cell proliferation and viability through the AKT/FoxO pathway. J Cancer Res Clin Oncol. 2017 May;143(5):793-805. doi: 10.1007/s00432-016-2333-y. Epub 2017 Feb 22. PMID: 28229220.