Search by BoMiProt ID - Bomi6224


Primary Information

BoMiProt ID Bomi6224
Protein Name Heparanase
Organism Bos taurus
Uniprot IdQ9MYY0
Milk FractionWhey,MFGM
Ref Sequence Id NP_776507.1
Aminoacid Length 545
Molecular Weight 61077
Fasta Sequence https://www.uniprot.org/uniprot/Q9MYY0.fasta
Gene Name HPSE
Gene Id 281230
Protein Existence Status reviewed

Secondary Information

Protein Function HPSE regulates the classic and emerging hallmarks of cancer as well as regulating pro inflammatory immune cell migration and activation.
Biochemical Properties Heparanase is the only mammalian enzyme that cleaves heparan sulphate, an important component of the extracellular matrix. This leads to the remodelling of the extracellular matrix, whilst liberating growth factors and cytokines bound to heparan sulphate. This in turn promotes both physiological and pathological processes such as angiogenesis, immune cell migration, inflammation, wound healing and metastasis. 
Significance in milk Granulosa-derived heparanase is a novel member of the luteinizing hormone-induced extracellular matrix-degrading enzymes contributing to follicular rupture and ovulation.
PTMs N-linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9MYY0|HPSE_BOVIN Heparanase OS=Bos taurus OX=9913 GN=HPSE PE=2 SV=2 MLACRKPGLRPPLLLLLPLLGPLGPCSPGTPAAAAPADDAAELEFFTERPLHLVSPAFLS FTIDANLATDPRFFTFLGSSKLRTLARGLAPAYLRFGGNKGDFLIFDPKKEPAFEERSYW LSQSNQDICKSGSIPSDVEEKLRLEWPFQEQVLLREQYQKKFTN*164STYSRSSVDMLYTFAS CSGLNLIFGVNALLRTTDMHWDSSNAQLLLDYCSSKNYN*219ISWELGNEPNSFQRKAGIFIN GRQLGEDFIEFRKLLGKSAFKNAKLYGPDIGQPRRNTVKMLKSFLKAGGEVIDSVTWHHY YVNGRIATKEDFLNPDILDTFISSVQKTLRIVEKIRPLKKVWLGETSSAFGGGAPFLSNT FAAGFMWLDKLGLSARMGIEVVMRQVLFGAGNYHLVDGNFEPLPDYWLSLLFKKLVGNKV LMASVKGPDRSKFRVYLHCTNTKHPRYKEGDLTLYALNLHN*461VTKHLELPHHLFNKQVDKY LIKPSGTDGLLSKSVQLNGQILKMVDEQTLPALTEKPLHPGSSLGMPPFSYGFFVIRNAK VAACI
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments However, recent discoveries which demonstrated that heparanase can also regulate vital anti-tumour mechanisms have cast doubt on the cancer hallmark approach.
Bibliography Jayatilleke KM, Hulett MD. Heparanase and the hallmarks of cancer. J Transl Med. 2020 Nov 30;18(1):453. doi: 10.1186/s12967-020-02624-1. PMID: 33256730; PMCID: PMC7706218. 2.Eyal Klipper, Ehud Tatz, Tatiana Kisliouk, Israel Vlodavsky, Uzi Moallem, Dieter Schams, Yaniv Lavon, David Wolfenson, Rina Meidan, Induction of Heparanase in Bovine Granulosa Cells by Luteinizing Hormone: Possible Role during the Ovulatory Process, Endocrinology, Volume 150, Issue 1, 1 January 2009, Pages 413–421, https://doi.org/10.1210/en.2008-0697