Search by BoMiProt ID - Bomi6202


Primary Information

BoMiProt ID Bomi6202
Protein Name Heat shock factor protein 1/Heat shock transcription factor 1/ HSTF 1/HSF 1
Organism Bos taurus
Uniprot IdQ08DJ8
Milk FractionWhey
Ref Sequence Id NP_001070277.1
Aminoacid Length 525
Molecular Weight 56702
Fasta Sequence https://www.uniprot.org/uniprot/Q08DJ8.fasta
Gene Name HSF1
Gene Id 506235
Protein Existence Status reviewed

Secondary Information

Protein Function Functions as a stress-inducible and DNA-binding transcription factor that plays a central role in the transcriptional activation of the heat shock response (HSR), leading to the expression of a large class of molecular chaperones heat shock proteins (HSPs) that protect cells from cellular insults' damage.
PTMs Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DJ8|HSF1_BOVIN Heat shock factor protein 1 OS=Bos taurus OX=9913 GN=HSF1 PE=2 SV=1 MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVLDQGQFAKEVLPKY FKHSNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT S*121VSTLRSEDIKIRQDSVTKLLT*142DVQLMKGKQESMDSKLLAMKHENEALWREVASLRQKHA QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDGGPAHPMPKYGRQYS*230LEHIHGPGPY PAPSPAYSGSSLYSPDAVTSSGPIISDITELAPGS*275PVASSGGSVDERPLSSS*292PLVRVKEE PPS*303PPQS*307PRAEGAS*314PGRPS*319S*320MVET*324PLS*327PTTLIDSILRESEPTPVAS*346TTPLVDTGGRPPS*359PLPASAPEKCLSVACLDKTELSDHLDAMDSNLDNLQTMLTSHGFSVDTSTLLDLFS*415PSVTVPDMSLPDLDSSLASIQELLS*440PQEPPRPLEAEKSSPDSGKQLVHYTAQPLLLLDPGSVDVG SSDLPVLFELGEGSYFSEGDDYSDDPTISLLTGSEPPKAKDPTVS
Predicted Disorder Regions 10 predicted disordered segments; (4-10), (86-91), (125-127), (149-153), (254-256), (285-329), (346-358), (369-371), (400-410), (421-525)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Acetylated on Lys-118; this acetylation is decreased in a IER5-dependent manner. Acetylated on Lys-118, Lys-208 and Lys-298; these acetylations occur in a EP300-dependent manner. Acetylated on Lys-80; this acetylation inhibits DNA-binding activity upon heat shock. Deacetylated on Lys-80 by SIRT1; this deacetylation increases DNA-binding activity.Phosphorylated on Ser-415 by PLK1; phosphorylation promotes nuclear translocation upon heat shock.Phosphorylated on Thr-142; this phosphorylation increases HSF1 transactivation activity upon heat shock.