Search by BoMiProt ID - Bomi6190


Primary Information

BoMiProt ID Bomi6190
Protein Name HBS1-like protein
Organism Bos taurus
Uniprot IdQ2KHZ2
Milk FractionWhey
Ref Sequence Id NP_001039963.1
Aminoacid Length 686
Molecular Weight 75850
Fasta Sequence https://www.uniprot.org/uniprot/Q2KHZ2.fasta
Gene Name HBS1L
Gene Id 541083
Protein Existence Status reviewed

Secondary Information

Protein Function Hbs1 has been established as a central component of the cell's translational quality control pathways in both yeast and prokaryotic models
Biochemical Properties Hbs1L belongs to a specialized family of translational GTPases (trGTPases), members of which are structurally homologous but functionally distinct [1]. Each trGTPase binds to a specific “decoding” protein and transports it to the ribosomal A site, where it recognizes a unique mRNA code.
PTMs N6-Acetylation at Lys and Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus OX=9913 GN=HBS1L PE=2 SV=1 MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPS*49AVEPVEEYDYE DLKEFSSS*68FVNHQLSGIDQARLYSCLDHMREVLGDAVPDDILIEAVLKNKFDVQKALS*118VV LEQDKVQNLKVRSEGAISTGKIAKGKSIDSQSS*153QS*155ESEIVPKVTKMTVSGKKQTMGFEVP RVTAEENGHSFHTPQKGHSSEDTSLVSSDALESASKSALPSHTIQASEEQSST*233PTPVKKS GKLRQQIDIKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHLLYLLGDVNKRTMHKYEQE SKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETKTKVITLMDAPGHKDFIPNMITG AAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQVNWQQERF QEITGKLGHFLKQAGFKESDVAFIPTSGLSGENLITRSQSSELTKWYKGLCLLEQIDSFK PPQRSIDKPFRLCVSDVFKDQGSGFCVTGKIEAGYIQTGDRLLAMPPNETCTAKGITLHD EPVDWAAAGDHVSLTLVGMDIIKINVGCIFCVPKEPIKVCTRFRARILIFNIEIPITKGF PVLLHYQTVSEPAVIKRLISVLNK*624STGEVTKKKPKLLTKGQNALVELQTQRPVALELYKD FKELGRFMLRYSGSTIAAGVVTEIKD
Predicted Disorder Regions 134-246
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments lack of Hbs1L caused depletion of Pelota protein in both patient cells and mouse tissues, while PELO mRNA levels were unaffected.Hbs1L-deficient human shows facial dysmorphism, growth restriction and retinal deposits.
Bibliography 1.O'Connell AE, Gerashchenko MV, O'Donohue MF, Rosen SM, Huntzinger E, Gleeson D, Galli A, Ryder E, Cao S, Murphy Q, Kazerounian S, Morton SU, Schmitz-Abe K, Gladyshev VN, Gleizes PE, Séraphin B, Agrawal PB. Mammalian Hbs1L deficiency causes congenital anomalies and developmental delay associated with Pelota depletion and 80S monosome accumulation. PLoS Genet. 2019 Feb 1;15(2):e1007917. doi: 10.1371/journal.pgen.1007917. PMID: 30707697; PMCID: PMC6373978. 2.The elongation, termination, and recycling phases of translation in eukaryotes. Dever TE, Green R Cold Spring Harb Perspect Biol. 2012 Jul 1; 4(7):a013706.