Primary Information |
---|
BoMiProt ID | Bomi6168 |
---|
Protein Name | Guanine nucleotide exchange factor for Rab-3A/Rab-3A-interacting-like protein 1/Rab3A-interacting-like protein 1/Rabin3-like 1 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q2KJ58 |
---|
Milk Fraction | Whey,MFGM |
---|
Ref Sequence Id | NP_001039997.1 |
---|
Aminoacid Length | 390 |
---|
Molecular Weight | 43325 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q2KJ58.fasta |
---|
Gene Name | RAB3IL1 |
---|
Gene Id | 614335 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | interacts with both InsP6K1 and Rab3A, a Ras-like GTPase that regulates synaptic vesicle exocytosis.GRAB regulates depolarization-induced adrenal chromaffin cells is indicated by augmentation
release of dopamine from PC12 cells and nicotinic of such release in cells depleted of endogenous GRAB
agonist-induced hGH release from bovine adrenal and inhibition of such release in cells transfected with
chromaffin cells. |
---|
Biochemical Properties | GRAB is a physiologic GEF for Rab3A, as depletion of endogenous GRAB markedly reduces GTP loading of Rab3A. Binding of GRAB to Rab3A is mediated by a coiled-coil domain of GRAB, which also mediates its binding to InsP6K1 so that InsP6K1 and Rab3A compete for binding to GRAB |
---|
PTMs | Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KJ58|R3GEF_BOVIN Guanine nucleotide exchange factor for Rab-3A OS=Bos taurus OX=9913 GN=RAB3IL1 PE=2 SV=1
MWSGQPHPDEGHPPPLEAVPVPWKSVGPCKSHRESLGGLPETPAGEEAQGEEGPAATQLD
VSRLRSSSMEIREKGSEFLKEELHKAQKELKLKDEECERLSKVREQLEQELEELTASLFE
EAHKMVREANMKQAASEKQLKEARGKIDMLQAEVTALKTLVITSTPAS*168PNRELHPQLLS*179P
TKAGPRKGHLRHKSTSSALCPAVCPVAGHILTPDKEGKEVDTTLFAEFQAWRESPTLDKT
SPFLERVYREDVGPCLDFTMQELSALVRAAVEDNTLTIEPVASQTLPAVKVAAVDCGHTN
GFRAPIDTTCALSGLACACRHRIRLGDSESHYYISPSSRARITAVCNFFTYIRYIQQGLV
RQDAEPMFWEITRLRKEMSLAKLGFFPHEA |
---|
Predicted Disorder Regions | 1-103, 114-143, 164-203 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | GRAB appears to be the mammalian ortholog of the yeast GEF Sec2p, as Sec2p is the yeast protein displaying greatest homology to GRAB, and both proteins have GEF functions |
---|
Bibliography | 1.Hongbo R. Luo; Adolfo Saiardi; Eiichiro Nagata; Keqiang Ye; Hongbo Yu; Thomas S. Jung; Xiaojiang Luo; Sima Jain; Akira Sawa; Solomon H. Snyder (2001). GRAB: A Physiologic Guanine Nucleotide Exchange Factor for Rab3a, which Interacts with Inositol Hexakisphosphate Kinase. , 31(3), 0–451. doi:10.1016/s0896-6273(01)00384-1 |