Search by BoMiProt ID - Bomi6168


Primary Information

BoMiProt ID Bomi6168
Protein Name Guanine nucleotide exchange factor for Rab-3A/Rab-3A-interacting-like protein 1/Rab3A-interacting-like protein 1/Rabin3-like 1
Organism Bos taurus
Uniprot IdQ2KJ58
Milk FractionWhey,MFGM
Ref Sequence Id NP_001039997.1
Aminoacid Length 390
Molecular Weight 43325
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJ58.fasta
Gene Name RAB3IL1
Gene Id 614335
Protein Existence Status reviewed

Secondary Information

Protein Function interacts with both InsP6K1 and Rab3A, a Ras-like GTPase that regulates synaptic vesicle exocytosis.GRAB regulates depolarization-induced adrenal chromaffin cells is indicated by augmentation release of dopamine from PC12 cells and nicotinic of such release in cells depleted of endogenous GRAB agonist-induced hGH release from bovine adrenal and inhibition of such release in cells transfected with chromaffin cells.
Biochemical Properties GRAB is a physiologic GEF for Rab3A, as depletion of endogenous GRAB markedly reduces GTP loading of Rab3A. Binding of GRAB to Rab3A is mediated by a coiled-coil domain of GRAB, which also mediates its binding to InsP6K1 so that InsP6K1 and Rab3A compete for binding to GRAB
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJ58|R3GEF_BOVIN Guanine nucleotide exchange factor for Rab-3A OS=Bos taurus OX=9913 GN=RAB3IL1 PE=2 SV=1 MWSGQPHPDEGHPPPLEAVPVPWKSVGPCKSHRESLGGLPETPAGEEAQGEEGPAATQLD VSRLRSSSMEIREKGSEFLKEELHKAQKELKLKDEECERLSKVREQLEQELEELTASLFE EAHKMVREANMKQAASEKQLKEARGKIDMLQAEVTALKTLVITSTPAS*168PNRELHPQLLS*179P TKAGPRKGHLRHKSTSSALCPAVCPVAGHILTPDKEGKEVDTTLFAEFQAWRESPTLDKT SPFLERVYREDVGPCLDFTMQELSALVRAAVEDNTLTIEPVASQTLPAVKVAAVDCGHTN GFRAPIDTTCALSGLACACRHRIRLGDSESHYYISPSSRARITAVCNFFTYIRYIQQGLV RQDAEPMFWEITRLRKEMSLAKLGFFPHEA
Predicted Disorder Regions 1-103, 114-143, 164-203
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments GRAB appears to be the mammalian ortholog of the yeast GEF Sec2p, as Sec2p is the yeast protein displaying greatest homology to GRAB, and both proteins have GEF functions
Bibliography 1.Hongbo R. Luo; Adolfo Saiardi; Eiichiro Nagata; Keqiang Ye; Hongbo Yu; Thomas S. Jung; Xiaojiang Luo; Sima Jain; Akira Sawa; Solomon H. Snyder (2001). GRAB: A Physiologic Guanine Nucleotide Exchange Factor for Rab3a, which Interacts with Inositol Hexakisphosphate Kinase. , 31(3), 0–451. doi:10.1016/s0896-6273(01)00384-1