Search by BoMiProt ID - Bomi6154


Primary Information

BoMiProt ID Bomi6154
Protein Name GTPase Era, mitochondrial/ERA-like protein 1
Organism Bos taurus
Uniprot IdA5PK43
Milk FractionWhey
Ref Sequence Id NP_001092492.1
Aminoacid Length 437
Molecular Weight 48567
Fasta Sequence https://www.uniprot.org/uniprot/A5PK43.fasta
Gene Name ERAL1
Gene Id 523344
Protein Existence Status reviewed

Secondary Information

Protein Function Probable GTPase that plays a role in the mitochondrial ribosomal small subunit assembly. Specifically binds the 12S mitochondrial rRNA (12S mt-rRNA) to a 33 nucleotide section delineating the 3' terminal stem-loop region. May act as a chaperone that protects the 12S mt-rRNA on the 28S mitoribosomal subunit during ribosomal small subunit assembly
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5PK43|ERAL1_BOVIN GTPase Era, mitochondrial OS=Bos taurus OX=9913 GN=ERAL1 PE=2 SV=1 MAASSWRGAVLLRTVSGLWQAGPDAAREWMTRLPSLLGFQQRCVSCVAGPAFSGPRLASA SRPNGQNSALDCFLGLSQPDNSLPFRVPAVSVHRDEQDLLLVHRPDMPENPRVLRVVLLG APNAGKSTLSNQLLGRKVFPVSKKVHTTRSQALGVITEKETQVILLDTPGLIS*173PAKQKRH HLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQVLRCLTQFSQVPSILVMNKVDC LKQKSVLLELTAALTEGVVNGKKLKTKQALRSRPDTHCPSPAAQGPNPQPVRDPQQMGWP HFQEIFMLSALSQEDVKTLKQYLLAQARPGPWEFHSEVLTSQTPEEICANMIREKLLEYL PEEVPYNVQQKTVVWDEGPSGELVIEQKLLVSKESHMKILIGPKGYLIAQIAQEVGRDLM NIFLCEVQLRLSVKLLK
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Dennerlein, S., Rozanska, A., Wydro, M., Chrzanowska-Lightowlers, Z. M., & Lightowlers, R. N. (2010). Human ERAL1 is a mitochondrial RNA chaperone involved in the assembly of the 28S small mitochondrial ribosomal subunit. The Biochemical journal, 430(3), 551–558. https://doi.org/10.1042/BJ20100757