Search by BoMiProt ID - Bomi6140


Primary Information

BoMiProt ID Bomi6140
Protein Name Growth/differentiation factor 10(GDF 10)/Bone morphogenetic protein 3B(BMP 3B)
Organism Bos taurus
Uniprot IdQ08DX6
Milk FractionWhey,exosome
Ref Sequence Id NP_001069635.1
Aminoacid Length 478
Molecular Weight 52626
Fasta Sequence https://www.uniprot.org/uniprot/Q08DX6.fasta
Gene Name GDF10/BMP3B
Gene Id 539510
Protein Existence Status reviewed

Secondary Information

Protein Function also known as BMP-3b,capable of inhibiting osteoblast differentiation by antagonizing BMP-2 and -4 -mediated osteogenesis.Acts as a regulator of hepatic PPARγ during conditions of dietary stress.
Biochemical Properties member of the TGFβ superfamily
PTMs Cleavage on pair of basic residues, Disulfide bond formation, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DX6|GDF10_BOVIN Growth/differentiation factor 10 OS=Bos taurus OX=9913 GN=GDF10 PE=2 SV=1 MARGPARTSLGPGSQQLPLLSLLLLLLLRDADGSHTAAARPPPPAAADGLAGDKNPQRSP GDVAAAQSPGAQDMVAVHMLRLYEKYSRRGARPGGGNTVRSFRARLEVVNQKAVYFFN*118LT SMQDSEMILTATFHFYSEPQWPPAREVPCKQRAKN*155ASCRLLPPGPPARQHLLFRSLSQNT ATQGLLRGAMALPPPPRGLWQAKDISLIVKAARRDGELLLSAQLDSGEKDTGVPRLGPHA PYILIYANDLAISEPNSVAVTLQRYDPFQAGDPEPGAAPN*280SSADPRVRRATQATGPLQNN ELPGLDERPAQAPHAQHYHKHELWPNPLRALKPRPGRKDRRKKGQDVFMASSQVLDFDEK TMQKARKKQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCSGACEFPMPKMVRPS NHATIQSIVRAVGIVPGIPEPCCVPDKMSSLGVLFLDENRNVVLKVYPN*469MSVETCACR
Predicted Disorder Regions 4-14, 35-71, 146-163, 275-283, 336-345
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments In vitro knockdown of GDF10 enhances adipogenesis and that transgenic mice overexpressing GDF10 are protected against diet-induced obesity and insulin resistance.
Bibliography Platko K, Lebeau PF, Byun JH, Poon SV, Day EA, MacDonald ME, Holzapfel N, Mejia-Benitez A, Maclean KN, Krepinsky JC, Austin RC. GDF10 blocks hepatic PPARγ activation to protect against diet-induced liver injury. Mol Metab. 2019 Sep;27:62-74. doi: 10.1016/j.molmet.2019.06.021. Epub 2019 Jun 28. PMID: 31288993; PMCID: PMC6717799.