Primary Information |
---|
BoMiProt ID | Bomi6127 |
---|
Protein Name | Growth arrest and DNA damage-inducible protein GADD45 alpha |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q3ZBN6 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001029419.1 |
---|
Aminoacid Length | 165 |
---|
Molecular Weight | 18337 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q3ZBN6.fasta |
---|
Gene Name | GADD45A |
---|
Gene Id | 505463 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | GADD45A is an epigenetic R-loop reader that recruits the demethylation machinery to promoter CGIs.. Binds directly to R-loops and mediates local DNA demethylation by recruiting TET1 (ten-eleven translocation 1).R-loops are DNA-RNA hybrids enriched at CpG islands (CGIs) that can regulate chromatin states. |
---|
PTMs | Phosphorylation on Thr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBN6|GA45A_BOVIN Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Bos taurus OX=9913 GN=GADD45A PE=2 SV=1
MT*2LEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
---|
Predicted Disorder Regions | 1-19, 108-119 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | Arab K, Karaulanov E, Musheev M, Trnka P, Schäfer A, Grummt I, Niehrs C. GADD45A binds R-loops and recruits TET1 to CpG island promoters. Nat Genet. 2019 Feb;51(2):217-223. doi: 10.1038/s41588-018-0306-6. Epub 2019 Jan 7. PMID: 30617255; PMCID: PMC6420098. |