Search by BoMiProt ID - Bomi6127


Primary Information

BoMiProt ID Bomi6127
Protein Name Growth arrest and DNA damage-inducible protein GADD45 alpha
Organism Bos taurus
Uniprot IdQ3ZBN6
Milk FractionWhey
Ref Sequence Id NP_001029419.1
Aminoacid Length 165
Molecular Weight 18337
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBN6.fasta
Gene Name GADD45A
Gene Id 505463
Protein Existence Status reviewed

Secondary Information

Protein Function GADD45A is an epigenetic R-loop reader that recruits the demethylation machinery to promoter CGIs.. Binds directly to R-loops and mediates local DNA demethylation by recruiting TET1 (ten-eleven translocation 1).R-loops are DNA-RNA hybrids enriched at CpG islands (CGIs) that can regulate chromatin states.
PTMs Phosphorylation on Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBN6|GA45A_BOVIN Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Bos taurus OX=9913 GN=GADD45A PE=2 SV=1 MT*2LEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA ADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLETDAGPAASEGAEQPP DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Predicted Disorder Regions 1-19, 108-119
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Arab K, Karaulanov E, Musheev M, Trnka P, Schäfer A, Grummt I, Niehrs C. GADD45A binds R-loops and recruits TET1 to CpG island promoters. Nat Genet. 2019 Feb;51(2):217-223. doi: 10.1038/s41588-018-0306-6. Epub 2019 Jan 7. PMID: 30617255; PMCID: PMC6420098.