Search by BoMiProt ID - Bomi6118


Primary Information

BoMiProt ID Bomi6118
Protein Name GRB2-associated-binding protein 1
Organism Bos taurus
Uniprot IdA6QLU3
Milk FractionExosomes
Ref Sequence Id NP_001094671.1
Aminoacid Length 694
Molecular Weight 76435
Fasta Sequence https://www.uniprot.org/uniprot/A6QLU3.fasta
Gene Name GAB1
Gene Id 540085
Protein Existence Status reviewed

Secondary Information

Protein Function Adapter protein that plays a role in intracellular signaling cascades triggered by activated receptor-type kinases. Plays a role in FGFR1 signaling. Probably involved in signaling by the epidermal growth factor receptor (EGFR) and the insulin receptor (INSR). Involved in the MET/HGF-signaling pathway.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLU3|GAB1_BOVIN GRB2-associated-binding protein 1 OS=Bos taurus OX=9913 GN=GAB1 PE=2 SV=1 MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT EEDPVKAPGSSLQAPADIPLAISTAPPSSQVGASAAAAPPPYQLISLPPHLETLGIQEDP QDYLLLINCQSKKPEPTRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGVNGFFQQHM MYDSPPSRAAS*251LS*253VDSSLYNLPRSYS*266HDVLPKVSPSSTEADGELYVFNTPSGTSSVEPQM RHVS*304ISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVDTC SITRTASDTDSSYCIPTAGLPPSRSNT*387ISTVDLNKLRKDASS*402QDCYDTPRTFPSDRSSSL EGFHNHFKIKNILTAGSVSSEELDENYVPMNPNS*454PPRQHSSSFTEPIQEANYVPMTPGTF DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLP EWEELQAPVRSPITRSFARDSSRFPLSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED SNLFGSNSLDGGNSPMIKPKGDKQVEY*627LDLDLDSGKST*638PPRKQKSSGSGSS*651VADERVDY*659VVVDQQKTLALKSTREAWTDGRQS*683TESETPAKNVK
Predicted Disorder Regions 146-166, 201-230, 253-276, 331-340, 366-384
DisProt Annotation
TM Helix Prediction No TM helices