Search by BoMiProt ID - Bomi6103


Primary Information

BoMiProt ID Bomi6103
Protein Name GPN-loop GTPase 1/XPA-binding protein 1
Organism Bos taurus
Uniprot IdA4FUD1
Milk FractionWhey
Ref Sequence Id NP_001076861.1
Aminoacid Length 373
Molecular Weight 41450
Fasta Sequence https://www.uniprot.org/uniprot/A4FUD1.fasta
Gene Name GPN1/XAB1
Gene Id 508522
Protein Existence Status reviewed

Secondary Information

Protein Function GTPase,cell growth in eukaryotes,microtubule assembly in nuclear part.
Biochemical Properties contains a unique and highly conserved GPN loop motif for activity and for nuclear localization of POLR2A/RPB1.
PTMs Acetylation,Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4FUD1|GPN1_BOVIN GPN-loop GTPase 1 OS=Bos taurus OX=9913 GN=GPN1 PE=2 SV=1 MAAPASATESQASGGPRPPACLLVLGMAGSGKTTFVQRLTGYLHSQGCPPYVINLDPAVH EVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVL IDTPGQIEVFTWSASGTIITEALASSFPTIVIYVMDTSRSTNPVTFMSNMLYACSILYKT KLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRV VGVSAVLGTGLDELFVQVASATEEYEREYRPEYERLKKSLASAQSQQQKEQLERLQKDMG S*301VALDTGTATGS*312SS*314PVLDPSDLILTRGT*328LDEEDEEADS*338DT*340DDIDHRVTEESREEPAFQNFMQESMAQYWKKNK
Predicted Disorder Regions 1-16, 271-373
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Forget D, Lacombe AA, Cloutier P, Al-Khoury R, Bouchard A, Lavallée-Adam M, Faubert D, Jeronimo C, Blanchette M, Coulombe B. The protein interaction network of the human transcription machinery reveals a role for the conserved GTPase RPAP4/GPN1 and microtubule assembly in nuclear import and biogenesis of RNA polymerase II. Mol Cell Proteomics. 2010 Dec;9(12):2827-39. doi: 10.1074/mcp.M110.003616. Epub 2010 Sep 20. PMID: 20855544; PMCID: PMC3002788.