Search by BoMiProt ID - Bomi6100


Primary Information

BoMiProt ID Bomi6100
Protein Name GPI transamidase component PIG-S/Phosphatidylinositol-glycan biosynthesis class S protein
Organism Bos taurus
Uniprot IdQ3SZL5
Milk FractionWhey
Ref Sequence Id NP_001029388.1
Aminoacid Length 555
Molecular Weight 61786
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZL5.fasta
Gene Name PIGS
Gene Id 504583
Protein Existence Status reviewed

Secondary Information

Protein Function Glycolipid biosynthesis.involved in the pathway glycosylphosphatidylinositol-anchor biosynthesis
PTMs Glycosylation on Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZL5|PIGS_BOVIN GPI transamidase component PIG-S OS=Bos taurus OX=9913 GN=PIGS PE=2 SV=3 MAATGAAATDLEVVRGKRAALFFATVVIVLGLPLWWKTTETYRAPLPYSQISGLNSLKLR LMVPVTVVFTQESVPLDDQEKLPFTVVHEREIPLKYKLKIKCRFQKAYRRALDHEEAALS LGNIQEAEAMLAEPSEQAEGSLTVYVISERCSLLPQDMMSYIGPKRMAVVRGITHREAFN IIGRRIIQVVQAMSLTEDVLAAALADHLPEDKWSSDKRRPLKSSLGYEITFSLLNPDPKS HDVHWDIEGAVRRYVQPFLSALSAAGN*267FSVDSQILYYAVLGVNPRFDSASSSYYLAAHSL PHVINPVESRLGSSAASLYPVLNFLLYVPELAHSPLYIQDKDGAPVATNAFHSPRWGGIM VYNVDPKAYN*370GSQLPVRVEVDMMRVMEVFLAQLRLLFGIAQPQLPPKCLFFGPKSEGIMT WELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYRAVAAVQKAAEELS SGHLASAFAASQEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLFKI FLETRKSWKKPEKTD
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 2TMHs; (20-38) and (520-542)