Search by BoMiProt ID - Bomi6091


Primary Information

BoMiProt ID Bomi6091
Protein Name Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase
Organism Bos taurus
Uniprot IdQ2KJ53
Milk FractionWhey
Ref Sequence Id NP_001039800.1
Aminoacid Length 362
Molecular Weight 38924
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJ53.fasta
Gene Name BPNT2
Gene Id 532797
Protein Existence Status reviewed

Secondary Information

Protein Function This protein may play a role in the formation of skeletal elements derived through endochondral ossification,by clearing adenosine 3',5'-bisphosphate produced by Golgi sulfotransferases during glycosaminoglycan sulfation.
Biochemical Properties BPNT2 catalyzes the breakdown of 3'-phosphoadenosine-5'-phosphate, a by-product of glycosaminoglycan (GAG) sulfation.
PTMs Acetylation and N-linked Glycosylation at Asn,Autophosphorylation at various serine and threonine residues.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJ53|IMPA3_BOVIN Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase OS=Bos taurus OX=9913 GN=BPNT2 PE=2 SV=1 MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAGPAASAD GGTVDLREMLAVSVLAAVRGGEEVRRVRESNVLHEKSKGKTREGADDKMTSGDVLSNRKM FYLLKTAFPSVQINTEEHVDASDQEVILWDRKIPEDILKEIATPQEVPAESVTVWIDPLD ATQEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSEYTAWAMVDGGSNVKARTSYNEKTP RIVVSRSHSGMVKQVALQTFGN*262QTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIK KWDICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTG HK
Predicted Disorder Regions 45-58, 91-106, 162-166, 354-362
DisProt Annotation
TM Helix Prediction 1TMH; (11-33)
Significance of PTMs Autophosphorylation does not impair its ability to phosphorylate p53/TP53. Phosphorylation by PLK3 leads to induction of Golgi fragmentation during mitosis 
Additional Comments BPNT2, a known target of lithium, is important for glycosaminoglycan sulfation in the brain, suggesting that lithium-mediated inhibition of BPNT2 in the nervous system warrants further investigation.
Bibliography 1.Eisele BS, Wu AJ, Luka Z, Hale AT, York JD. Bisphosphate nucleotidase 2 (BPNT2), a molecular target of lithium, regulates chondroitin sulfation patterns in the cerebral cortex and hippocampus. Adv Biol Regul. 2021 Dec 9:100858. doi: 10.1016/j.jbior.2021.100858. Epub ahead of print. PMID: 34920982. 2.Eisele BS, Luka Z, Wu AJ, Yang F, Hale AT, York JD. Sulfation of glycosaminoglycans depends on the catalytic activity of lithium-inhibited phosphatase BPNT2 in vitro. J Biol Chem. 2021 Nov;297(5):101293. doi: 10.1016/j.jbc.2021.101293. Epub 2021 Oct 8. PMID: 34634304; PMCID: PMC8551643.