Search by BoMiProt ID - Bomi6059


Primary Information

BoMiProt ID Bomi6059
Protein Name Glycerol-3-phosphate dehydrogenase, mitochondrial/GPD-M/GPDH-M
Organism Bos taurus
Uniprot IdA6QLU1
Milk FractionWhey,MFGM
Ref Sequence Id NP_001093766.1
Aminoacid Length 727
Molecular Weight 80763
Fasta Sequence https://www.uniprot.org/uniprot/A6QLU1.fasta
Gene Name GPD2
Gene Id 504948
Protein Existence Status reviewed

Secondary Information

Protein Function  a component of the glycerol phosphate shuttle, boosted glucose oxidation to fuel the production of acetyl-coA, acetylation of histones and induction of genes encoding inflammatory mediators.The main metabolic role of this shuttle is reoxidation of cytosolic NADH produced by glycolysis.This enables sustained rate of cytosolic ATP production without accumulation of an intermediate by-product such as lactic acid.
Biochemical Properties Calcium-binding enhance the activity of the enzyme.binds to FAD as cofactor.that oxidizes glycerol-3-phosphate (G3P) to dihdroxy acetone phosphate(DHAP).Kinetic properties of isolated mGPDH revealed 2.9 mM Km for G3P and ~ 7 μM Km for FAD in rat liver enzyme
PTMs Proteolytic cleavage,Phosphorylation on Tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLU1|GPDM_BOVIN Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=GPD2 PE=2 SV=1 MAFQKAVKGTILVGGGALATVLGLSHFAHYKRKQVNLAFVEAADCISEPVNREPPSREAQ ILTLKNTSEFDVLVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG AATANYMEVMSLLKKTDPQTGKERVSGARCKDVLTGEEFDVRAKCVINATGPFTDTVRKM DDKDTTAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTKSISRNH VVDISESGLITIAGGKWTTYRSMAEDTINAAVKAHNLKAGPSRTVGLFLQGGKDWSPTLY IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDSKKEEELETARKFLY Y*601EMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESIGVQMD ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV DRSCGGL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; (11-29)
Significance of PTMs Proteolytic digestion-Rat mGPDH is synthesized as 79 kDa precursor that is processed to ~ 74 kDa mature protein upon removal of the N terminal(5kDa) presequence,after import into the mitochondria.
Bibliography Langston PK, Nambu A, Jung J, Shibata M, Aksoylar HI, Lei J, Xu P, Doan MT, Jiang H, MacArthur MR, Gao X, Kong Y, Chouchani ET, Locasale JW, Snyder NW, Horng T. Glycerol phosphate shuttle enzyme GPD2 regulates macrophage inflammatory responses. Nat Immunol. 2019 Sep;20(9):1186-1195. doi: 10.1038/s41590-019-0453-7. Epub 2019 Aug 5. Erratum in: Nat Immunol. 2019 Sep 24;: PMID: 31384058; PMCID: PMC6707851.