Search by BoMiProt ID - Bomi6058


Primary Information

BoMiProt ID Bomi6058
Protein Name Glycerol-3-phosphate acyltransferase 4
Organism Bos taurus
Uniprot IdA3FPG8
Milk FractionExosomes
Ref Sequence Id NP_001077138.1
Aminoacid Length 456
Molecular Weight 52055
Fasta Sequence https://www.uniprot.org/uniprot/A3FPG8.fasta
Gene Name GPAT4
Gene Id 511614
Protein Existence Status reviewed

Secondary Information

Protein Function Participate in CDP-diacylglycerol biosynthesis.Converts glycerol-3-phosphate to 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) by incorporating an acyl moiety at the sn-1 position of the glycerol backbone.
Biochemical Properties The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A3FPG8|GPAT4_BOVIN Glycerol-3-phosphate acyltransferase 4 OS=Bos taurus OX=9913 GN=GPAT4 PE=3 SV=1 MFLLLPFDSLIVSLLGISLTVLFTLLLVFIIVPAVFGVSFGIRKLYMKTLLKIFAWATLR MERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCR KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCLLLSLRI ALAFTGISLLVVGTTMVGYLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHDRKNRPRN GGICVAN*247HTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL VARRLTEHVQDKSKLPILIFPEGTCIN*327N*328TSVMMFKKGSFEIGATVYPVAIKYDPQFGDAF WN*362SSKYGMVTYLLRMMTSWAIVCSVWYLPPMTRQAEEDAVQFANRVKSAIARQGGLVDLL WDGGLKREKVKDTFKEEQQKLYSKMIVGNHEDRSRS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 2TMHs; (19-41),(178-200)