Search by BoMiProt ID - Bomi6056


Primary Information

BoMiProt ID Bomi6056
Protein Name Glycerate kinase
Organism Bos taurus
Uniprot IdQ2KJF7
Milk FractionWhey
Ref Sequence Id NP_001039452.1
Aminoacid Length 523
Molecular Weight 54720
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJF7.fasta
Gene Name GLYCTK
Gene Id 507949
Protein Existence Status reviewed

Secondary Information

Protein Function Take part in Entner-Doudoroff (ED) pathway.This protein phosphorylates (R)-glycerate utilising an ATP molecule to yield (2R)-3-phosphoglycerate and an ADP molecule.
Biochemical Properties Glycerate is phosphorylated via glycerate kinase, the key enzyme of the npED branch, forming 2-phosphoglycerate.(R)-glycerate + ATP = (2R)-3-phosphoglycerate + ADP + H+. 3 classes of glycerate kinase-(i) class I (GK I), ii) the glycerate kinase class II (GK II, MOFRL family) as well as iii) a novel glycerate kinase family related to the phosphoribulokinase/uridine kinase family,named glycerate kinase class III (GK III).
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJF7|GLCTK_BOVIN Glycerate kinase OS=Bos taurus OX=9913 GN=GLYCTK PE=2 SV=1 MAAALQVLRHLARAPSGPLLWGGPLARMASSMALAEQARQLFESTVGAVLPGPLLQRALS*60 LDPDSGELKVRDRSFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAM EHAGKQEMLLKPHSRIQVFEGAEDNLPDRDALRAALAIRQLAEGLTADDLLLVLISGGGS ALLPAPIPPVTLEEKQTLTKLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLI LSDVVGDPVEVIASGPTVASIHSVQDCLYILNRYGLRTALPRSVKTVLARADSDPHGPHT CGHVLNVILGSNALALAEAQKQAEALGYRAVVLSTAIQGDVKSVAQFYGLLARVAGAHLA LPGAGASVQEDERLYELAADLQLPDLQLKEALEAVVGAPGPVCLLAGGEPTVRLQGSGKG GRNQELALRVGVELGQWPLGTVDVLFLSGGTDGQDGPTEAAGAWVRPELTSQAAAEGLDV ATFLAHNDSHTFFCRFQGGAHLLHTGLTGTNVTDAHFLFLHPQ
Predicted Disorder Regions (454-468)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Sass, J. O., Fischer, K., Wang, R., Christensen, E., Scholl-Bürgi, S., Chang, R., Kapelari, K., & Walter, M. (2010). D-glyceric aciduria is caused by genetic deficiency of D-glycerate kinase (GLYCTK). Human mutation, 31(12), 1280–1285. https://doi.org/10.1002/humu.21375