Search by BoMiProt ID - Bomi6046


Primary Information

BoMiProt ID Bomi6046
Protein Name Glutathione hydrolase 7/Gamma-glutamyltransferase 7/Gamma-glutamyltransferase-like 3/Gamma-glutamyltranspeptidase 7/GGT 7
Organism Bos taurus
Uniprot IdQ0V8L2
Milk Fractionwhey
Ref Sequence Id NP_001069869.1
Aminoacid Length 662
Molecular Weight 70652
Fasta Sequence https://www.uniprot.org/uniprot/Q0V8L2.fasta
Gene Name GGT7/GGTL3
Gene Id 615929
Protein Existence Status Reviewed

Secondary Information

Protein Function involved in the pathway glutathione metabolism.It cleaves glutathione conjugates.
Biochemical Properties Heterodimer composed of the light and heavy chains. The active site is located in the light chain.Catalyses the following reaction an α-amino acid + an N-terminal (5-L-glutamyl)-[peptide] = 5-L-glutamyl amino acid + N-terminal L-α-aminoacyl-[peptide]
PTMs Glycosylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0V8L2|GGT7_BOVIN Glutathione hydrolase 7 OS=Bos taurus OX=9913 GN=GGT7 PE=2 SV=1 MAAENEASQESALGAYS*17PVDYMSITSFPRLPEDEPAPAVPLRGRKDEDAFLGDPDTDPDS FLKSARLQRLPS*72SSSEMGS*79QDGS*83PLRETRKDPFSAAASECSCRQDGLTVIVTACLTFATG VTVALIMQIYFGDPQIFHQGAVVTDAARCTSLGIEVLSKQGSSVDAAVAAALCLGIVAPH SSGLGGGGVMLVHDIRRN*198KSHLIDFRESAPGALREEALQRSWETKPGLLVGVPGMVKGLH EAHQLYGRLPWSQVLAFAAAVAQDGFN*267VTHDLAQALAEQPPPN*283ASDRFRETFLPMGHPPL PGSLLRRPDLAAVLEVLGTYGPAAFYAGGN*330LTLEMVAEAQHAGGVITEEDFSN*353YSALLEK PVCGVYRGHLVLSPRPPHTGPALISALNILEGFN*394LTSLVSREQALHWVAETLKIALALAS RLGDPIYDSTITESMDDMLSKVEAAYFRGQIN*452DSQAAPVPLLPIYELNGAPTAAQVLIMG PDDFIVAMVSSLNRPFGSGLITPSGILLNSQMLDFSWPN*519RTANHPAPSLENSVQPGKRPL SFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRN*586LSDSLARGRLHPDL QTNLLQVDSEFTEEEIEFLEARGHHVEKVDVLSWVHGSRRTNNFIIGVKDPRSPDAAGAT IL
Predicted Disorder Regions 1-34,47-94
DisProt Annotation
TM Helix Prediction 1TMH; (109 131)
Bibliography Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166