Search by BoMiProt ID - Bomi6043


Primary Information

BoMiProt ID Bomi6043
Protein Name Glutathione hydrolase 6/Gamma-glutamyltransferase 6/Gamma-glutamyltranspeptidase 6
Organism Bos taurus
Uniprot IdA7YWM1
Milk FractionWhey
Ref Sequence Id NP_001098904.1
Aminoacid Length 490
Molecular Weight 49626
Fasta Sequence https://www.uniprot.org/uniprot/A7YWM1.fasta
Gene Name GGT6
Gene Id 613919
Protein Existence Status reviewed

Secondary Information

Protein Function role in glutathione homeostatsis.it hydrolyzes and transfers gamma-glutamyl moieties from glutathione and other gamma-glutamyl compounds to acceptors. As such, it has a critical function in the metabolism of glutathione and in the conversion of the leukotriene LTC4 to LTD4.
Biochemical Properties GGT hydrolyzes γ-glutamyl peptides but can also catalyze the transfer of γ-glutamyl groups between different compounds.
PTMs N-linked glycosylation on asparagine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7YWM1|GGT6_BOVIN Glutathione hydrolase 6 OS=Bos taurus OX=9913 GN=GGT6 PE=2 SV=1 MEPEAGPVLYQKLRVWEPSLESEEEEEEISEQLILDASGPHDSSGNKAGRLPGAWAQLVA ALLLLAIGFSLAVRQLCSSGASPGALGSGAPPASGHSHRPGVYHHGAIISPAAECSRLGR ELFVAGGNIVDAGVGAALCLAVVHPHTTGLGATYWGLFHN*160SSSGN*165STALTSGPAQTLAPG LGLPSALPALHMLHTHFGRLPWPHLLVGPISLAQKGFLVDTSLASALAAQDTKGLCPLLC HANGTPLGPGTQVTNTKLAAVLHKASLAPTPDLSGDALLSLLAEDLGLEGPSVGPRPTLE PALQLPLPQGILFTTPSPSAGPELLELLEASLQSAGPSPAPCPALPQAAAAPRSSVLATV DSSGSVLLLTSSLN*374SSFGSGHLSPSTGVLLSNLVAESAAGAWACPLIFRDISDDTEVDVL GLVASGTPAAARVMTHALLSHLARPQTPDQQGPTESPRACAQGTLLQVAAHTEHAHVSSV PSGCCPFQGF
Predicted Disorder Regions 5 disordered segments; (18-25), (41-46), (86-99), (335-348), (445-462)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Heisterkamp N, Groffen J, Warburton D, Sneddon TP. The human gamma-glutamyltransferase gene family. Hum Genet. 2008 May;123(4):321-32. doi: 10.1007/s00439-008-0487-7. Epub 2008 Mar 21. PMID: 18357469.