Search by BoMiProt ID - Bomi6038


Primary Information

BoMiProt ID Bomi6038
Protein Name Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2/D-fructose-6-phosphate amidotransferase 2/Glutamine:fructose-6-phosphate amidotransferase 2
Organism Bos taurus
Uniprot IdQ08DQ2
Milk FractionExosomes
Ref Sequence Id NP_001070351.1
Aminoacid Length 682
Molecular Weight 77081
Fasta Sequence https://www.uniprot.org/uniprot/Q08DQ2.fasta
Gene Name GFPT2
Gene Id 530101
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells diaphragm
Protein Function hGFAT2 is able to isomerize fructose-6-phosphate into glucose-6-phosphate even in the presence of equimolar amounts of glutamine, which results in unproductive glutamine hydrolysis.
Biochemical Properties The structure of GFAT is characterized by having two domains, glutaminase (GLN) and isomerase (ISOM), responsible for its enzymatic activity.Presence of a partially structured loop in the glutaminase domain, whose sequence is present in eukaryotic enzymes but absent in the E. coli homolog. Molecular dynamics simulations suggest that this loop is the most flexible portion of the protein and plays a key role on conformational states of hGFAT2.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DQ2|GFPT2_BOVIN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Bos taurus OX=9913 GN=GFPT2 PE=2 SV=1 MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNNEVKERHIQLVKKR GNVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHN GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYRTRNIENVKNICKTRMK RLDS*244STCLHAVGNKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRLAS DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF ISQSGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYT SQFISLVMFGLMMSEDRISLQNRRREIIHGLKSLPELIKEVLSLDEKIHDLALELYTQRS LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCF AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH LAVLRGYDVDFPRNLAKSVTVE
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Overexpression contributes to insulin resistance and higher O-GlcNAc levels.
Bibliography 1.Oliveira IA, Allonso D, Fernandes TVA, Lucena DMS, Ventura GT, Dias WB, Mohana-Borges RS, Pascutti PG, Todeschini AR. Enzymatic and structural properties of human glutamine:fructose-6-phosphate amidotransferase 2 (hGFAT2). J Biol Chem. 2021 Jan-Jun;296:100180. doi: 10.1074/jbc.RA120.015189. Epub 2020 Dec 17. PMID: 33303629; PMCID: PMC7948480.