Search by BoMiProt ID - Bomi6036


Primary Information

BoMiProt ID Bomi6036
Protein Name Glutamine synthetase/Glutamate--ammonia ligase/Palmitoyltransferase GLUL
Organism Bos taurus
Uniprot IdP15103
Milk FractionExosomes
Ref Sequence Id NP_001035564.1
Aminoacid Length 373
Molecular Weight 42031
Fasta Sequence https://www.uniprot.org/uniprot/P15103.fasta
Gene Name GLUL
Gene Id 281199
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  prefrontal cortex
Protein Function Glutamine synthetase assimilates ammonium into amino acids, thus it is a key enzyme for nitrogen metabolism.The cytosolic isoenzymes of glutamine synthetase assimilate ammonium derived from primary nitrogen uptake and from various internal nitrogen recycling pathways.
Biochemical Properties Some key domains of the GS protein are ATP-binding and glutamate-binding sites.
PTMs N-Acetylation at Ala,Palmitoylation, Phosphorylation at Ser/tyr, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P15103|GLNA_BOVIN Glutamine synthetase OS=Bos taurus OX=9913 GN=GLUL PE=2 SV=4 MATSASSHLNKGIKQVYMALPQGDKVQAMYIWIDGTGEGLRCKTRTLDSEPKCIEELPEW NFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKY*104NRKPAETNLRHTCKRI MDMVSNQRPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY RACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDP KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL TGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPS*343ANCDPFAVTEALIRTCL LNETGDEPFQYKN
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments GS1 activity may be downregulated via a chain of processes elicited by metabolic imbalances and environmental constraints. 
Bibliography 1.Bernard SM, Habash DZ. The importance of cytosolic glutamine synthetase in nitrogen assimilation and recycling. New Phytol. 2009;182(3):608-620. doi: 10.1111/j.1469-8137.2009.02823.x. PMID: 19422547. 2.Thomsen HC, Eriksson D, Møller IS, Schjoerring JK. Cytosolic glutamine synthetase: a target for improvement of crop nitrogen use efficiency? Trends Plant Sci. 2014 Oct;19(10):656-63. doi: 10.1016/j.tplants.2014.06.002. Epub 2014 Jul 10. PMID: 25017701.