Primary Information |
---|
BoMiProt ID | Bomi6036 |
---|
Protein Name | Glutamine synthetase/Glutamate--ammonia ligase/Palmitoyltransferase GLUL |
---|
Organism | Bos taurus |
---|
Uniprot Id | P15103 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence Id | NP_001035564.1 |
---|
Aminoacid Length | 373 |
---|
Molecular Weight | 42031 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/P15103.fasta |
---|
Gene Name | GLUL |
---|
Gene Id | 281199 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | prefrontal cortex |
---|
Protein Function | Glutamine synthetase assimilates ammonium into amino acids, thus it is a key enzyme for nitrogen metabolism.The cytosolic isoenzymes of glutamine synthetase assimilate ammonium derived from primary nitrogen uptake and from various internal nitrogen recycling pathways. |
---|
Biochemical Properties | Some key domains of the GS protein are ATP-binding and glutamate-binding sites. |
---|
PTMs | N-Acetylation at Ala,Palmitoylation, Phosphorylation at Ser/tyr, Ubl conjugation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P15103|GLNA_BOVIN Glutamine synthetase OS=Bos taurus OX=9913 GN=GLUL PE=2 SV=4
MATSASSHLNKGIKQVYMALPQGDKVQAMYIWIDGTGEGLRCKTRTLDSEPKCIEELPEW
NFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKY*104NRKPAETNLRHTCKRI
MDMVSNQRPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY
RACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPS*343ANCDPFAVTEALIRTCL
LNETGDEPFQYKN |
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | GS1 activity may be downregulated via a chain of processes elicited by metabolic imbalances and environmental constraints. |
---|
Bibliography | 1.Bernard SM, Habash DZ. The importance of cytosolic glutamine synthetase in nitrogen assimilation and recycling. New Phytol. 2009;182(3):608-620. doi: 10.1111/j.1469-8137.2009.02823.x. PMID: 19422547. 2.Thomsen HC, Eriksson D, Møller IS, Schjoerring JK. Cytosolic glutamine synthetase: a target for improvement of crop nitrogen use efficiency? Trends Plant Sci. 2014 Oct;19(10):656-63. doi: 10.1016/j.tplants.2014.06.002. Epub 2014 Jul 10. PMID: 25017701. |