Search by BoMiProt ID - Bomi6029


Primary Information

BoMiProt ID Bomi6029
Protein Name Glutamate-rich protein 5
Organism Bos taurus
Uniprot IdQ08DY0
Milk Fractionwhey
Ref Sequence Id NP_001071312.1
Aminoacid Length 453
Molecular Weight 47742
Fasta Sequence https://www.uniprot.org/uniprot/Q08DY0.fasta
Gene Name ERICH5
Gene Id 504339
Protein Existence Status reviewed

Secondary Information

PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DY0|ERIC5_BOVIN Glutamate-rich protein 5 OS=Bos taurus OX=9913 GN=ERICH5 PE=2 SV=1 MGCSSSALNKAGDDNRLRSATEESESCFVQPKPRALGRESTLCGKVQKESLPPLDKLKIS AVSTANGVQSLPEQPLAKEAADPPGATEETQPLQGLKGSEPPQPGGKDGAPGAEGKEEDV EAVTEAPPLKGSAETEPLGAEAENQPLITAGERDS*155TGAVEGTEDPQAAGEMTPLGTAERV PLEAAREPGSQEAGGKGEQSQLPETVPKETESPEILEGSQPVETAEPPQLQETVGENEQS QPLETVPKENASLEVSDGSQSVGAEGKKQLQETLGENEQSQLRETILGEHGGPEVSDGSQ SVGAEEEKRLQEMLGKDEQPQLRETIPREHGGPEMSDASQSVETAVKADSLHKAPEGPGN MEKIQPERTVESMEHPAGILETGAKVEMARKIHTNEEDQHIEGETGETVETEMESEKVSE GAETKEEETGEAMDLSAATQIGMDGRVKGHSML
Predicted Disorder Regions (1-453)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Su, D., Kosciuk, T., Yang, M., Price, I. R., & Lin, H. (2021). Binding Affinity Determines Substrate Specificity and Enables Discovery of Substrates for N-Myristoyltransferases. ACS catalysis, 11(24), 14877–14883. https://doi.org/10.1021/acscatal.1c03330