Search by BoMiProt ID - Bomi5998


Primary Information

BoMiProt ID Bomi5998
Protein Name Glucosamine-6-phosphate isomerase 1
Organism Bos taurus
Uniprot IdA4FV08
Milk FractionExosomes,MFGM
Ref Sequence Id NP_001073756.2
Aminoacid Length 289
Molecular Weight 32580
Fasta Sequence https://www.uniprot.org/uniprot/A4FV08.fasta
Gene Name GNPDA1
Gene Id 522919
Protein Existence Status reviewed

Secondary Information

Protein Function Seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo
Biochemical Properties Homohexamer.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4FV08|GNPI1_BOVIN Glucosamine-6-phosphate isomerase 1 OS=Bos taurus OX=9913 GN=GNPDA1 PE=2 SV=1 MKLIILDHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTPLGCYKKLIEYYKNGD LSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAADLQAECDA FEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKT*161LAMDTILANARFFDGDLAK VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCD EDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKEIEKSQSSKKPYSD
Predicted Disorder Regions 277-289
DisProt Annotation
TM Helix Prediction No TM helices