Search by BoMiProt ID - Bomi5988


Primary Information

BoMiProt ID Bomi5988
Protein Name Glia maturation factor gamma
Organism Bos taurus
Uniprot IdQ56JZ9
Milk FractionWhey
Ref Sequence Id NP_001019708.1
Aminoacid Length 142
Molecular Weight 16770
Fasta Sequence https://www.uniprot.org/uniprot/Q56JZ9.fasta
Gene Name GMFG
Gene Id 514407
Protein Existence Status reviewed

Secondary Information

Protein Function a novel regulator of the actin-related protein-2/3 complex, is predominantly expressed in inflammatory cells.plays a critical role in regulation of cellular iron metabolism and macrophage phenotype.belongs to the actin depolymerization factor/cofilin family and modulates actin cytoskeleton reorganization in microvascular endothelial cells and human airway smooth muscle.
Biochemical Properties Tyr-104 is a pivotal phosphorylation site on GMF-γ.Phosphorylation at Tyr-104 creates negative charges on the molecule, inducing conformational changes and the dissociation of GMF-γ from Arp2/3, which in turn modulates actin dynamics and cell contraction.
Significance in milk There is Increased expression of glia maturation factor gamma mRNA in the liver of feed-restricted cows,might be associated with disease pathogenesis.
PTMs Acetylation,phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q56JZ9|GMFG_BOVIN Glia maturation factor gamma OS=Bos taurus OX=9913 GN=GMFG PE=2 SV=1 MS*2DSLVVCEVDPELKEKLRKFRFRKETDNAAIVMKVDKDRQMVVLEEEFQNISPEELKME LPERQPRFVVYSYKYVHADGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKV FEIRTTDDLTEAWLKEKLSFFR
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Acetylcholine stimulation increased GMF-γ phosphorylation at Tyr-104. GMF-γ phosphorylation at this residue was mediated by c-Abl tyrosine kinase which has been found to regulate actin dynamics and contraction in human airway smooth muscle.
Additional Comments GMFG-knockdown murine macrophages exhibit an iron deficiency response and polarization toward the M2 phenotype.GMFG knockdown significantly decreased basal oxygen consumption.
Bibliography 1.Aerbajinai W, Ghosh MC, Liu J, Kumkhaek C, Zhu J, Chin K, Rouault TA, Rodgers GP. Glia maturation factor-γ regulates murine macrophage iron metabolism and M2 polarization through mitochondrial ROS. Blood Adv. 2019 Apr 23;3(8):1211-1225. doi: 10.1182/bloodadvances.2018026070. PMID: 30971398; PMCID: PMC6482362. 2.Wang T, Cleary RA, Wang R, Tang DD. Glia maturation factor-γ phosphorylation at Tyr-104 regulates actin dynamics and contraction in human airway smooth muscle. Am J Respir Cell Mol Biol. 2014 Nov;51(5):652-9. doi: 10.1165/rcmb.2014-0125OC. PMID: 24818551; PMCID: PMC4224085. 3.Loor JJ, Dann HM, Everts RE, Oliveira R, Green CA, Guretzky NA, Rodriguez-Zas SL, Lewin HA, Drackley JK. Temporal gene expression profiling of liver from periparturient dairy cows reveals complex adaptive mechanisms in hepatic function. Physiol Genomics 23: 217–226, 2005.