Search by BoMiProt ID - Bomi5982


Primary Information

BoMiProt ID Bomi5982
Protein Name Geranylgeranyl transferase type-2 subunit beta/Rab geranyl-geranyltransferase subunit beta/Type II protein geranyl-geranyltransferase subunit beta
Organism Bos taurus
Uniprot IdQ5E9B3
Milk FractionExosomes,MFGM
Ref Sequence Id NP_001015646.1
Aminoacid Length 331
Molecular Weight 36972
Fasta Sequence https://www.uniprot.org/uniprot/Q5E9B3.fasta
Gene Name RABGGTB
Gene Id 533276
Protein Existence Status Reviewed

Secondary Information

PTMs N-Acetylation at Gly, Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E9B3|PGTB2_BOVIN Geranylgeranyl transferase type-2 subunit beta OS=Bos taurus OX=9913 GN=RABGGTB PE=2 SV=1 MGT*3PQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLM GQLHRMNREEILTFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDINKVV EYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGG FGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVC YSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL LGEEQIKPVSPVFCMPEEVLRRVNVQPELVS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices