Primary Information |
---|
BoMiProt ID | Bomi5980 |
---|
Protein Name | Geranylgeranyl transferase type-2 subunit alpha/Geranylgeranyl transferase type II subunit alpha/Rab geranyl-geranyltransferase subunit alpha/Rab GG transferase alpha/Rab GGTase alpha/Rab geranylgeranyltransferase subunit alpha |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q5EA80 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001015614.1 |
---|
Aminoacid Length | 567 |
---|
Molecular Weight | 64945 |
---|
FASTA Sequence |
Download |
---|
Gene Name | RABGGTA |
---|
Gene ID | 516619 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Expression of DN GGTase I alpha-subunit inhibited insulin's ability to increase DNA synthesis, cell count, GGTase I activity, amounts of prenylated p21Ras and RhoA, and magnitude of phosphorylation of MAP kinase. |
---|
Biochemical Properties | 7 FTase and GGTase I are heterodimers and share the same a-subunit,8 whereas the b-subunit confers substrate specificity. |
---|
PTMs | Phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5EA80|PGTA_BOVIN Geranylgeranyl transferase type-2 subunit alpha OS=Bos taurus OX=9913 GN=RABGGTA PE=2 SV=1
MHGRLKVKTSEEQAEAKRLEREQKLKLYQAATQTVFQKRQAGELDESVLELTSQILGANP
DFATLWNCRREVLQQLEVQKSPEELATLVKAELGFLES*98CLRVNPKSYGTWHHRCWLLSRL
PEPNWARELELCARFLEVDERNFHCWDYRRFVAAQAAVPPAEELAFTDSLITRNFSNYSS
WHYRSCLLPQLHPQPDSGPQGRLPEDVLLKELELVQNAFFTDPNDQSAWFYHRWLLGRAD
PQDALRCLHVSRDEACLTVSFSRPLLVGSGMETLLLMVDESPLAVEWRTPEGRNRPSHIW
LCDLPATSLNDQLPQHTFRVIWTAGDAQKECVLLKGRQEGWCRDSATDEQLFRCELSVEK
STVLQSELESCKELQELEPENKWCLLTIILLMRALDPLQYEKETLQYFQTLKAVDPMRAA
YLDDLRSKFLLENSVLKMEYAEVRVLHLGHKDLTVLCHLEQLLLVTHLDLSHNRLRALPP
ALAALRCLEVLQANDNAIESLDGVTNLPRLQELILCNNRLQQPAVLQPLTSCPRLTLLNL
QGNPLCQAEGSSEHLAELLPSVSSILT |
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Insulin promotes the phosphorylation and activation of FTase and GGTase I and thereby increases the amounts of prenylated p21Ras and RhoA. |
---|
Additional Comments | Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of Rab proteins with the C-terminal sequence -XXCC, -XCXC and -CCXX, such as RAB1A, RAB3A, RAB5A and RAB7A. |
---|
Bibliography | 1.Solomon CS, Leitner JW, Goalstone ML. Dominant negative alpha-subunit of farnesyl- and geranylgeranyl-transferase I inhibits insulin-induced differentiation of 3T3-L1 pre-adipocytes. Int J Obes Relat Metab Disord. 2003 Jan;27(1):40-7. doi: 10.1038/sj.ijo.0802189. PMID: 12532152. 2.Moores SL, Schaber MD, Mosser SD, Rands E, O’Hara MB,
Garsky VM, Marshall MS, Pompliano DL, Gibbs JB. Sequence
dependence of protein isoprenylation. J Biol Chem 1991; 266:
4603 – 4610. 3. Caplin BE, Hettich LA, Marshall MS. Substrate characterization of
the Saccharomyces cerevisiae protein farnesyltransferase and type-I
protein geranylgeranyltransferase. Biochim Biophys Acta 1994;
1205: 39 – 48. 4. Golovchenko I, Goalstone ML, Watson P, Brownlee M, Draznin B.
Hyperinsulinemia enhances transcriptional activity of NFkB
induced by angiotensin II, hyperglycemia and advanced glycosylation end products in vascular smooth muscle cells. Circul Res
2000; 87: 746 – 752. 5. Chappell J, Golovchenko I, Wall K, Stjernholm J, Leitner JW,
Goalstone M, Draznin B. Potentiation of Rho-A-mediated lysophophatidic acid activity by hyperinsulinemia. J Biol Chem 2000;
275: 31792 – 31797. |