Primary Information |
---|
BoMiProt ID | Bomi5974 |
---|
Protein Name | General transcription factor IIF subunit 1/Transcription initiation factor IIF subunit alpha/TFIIF-alpha |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q5EA53 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001015527.1 |
---|
Aminoacid Length | 517 |
---|
Molecular Weight | 58262 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q5EA53.fasta |
---|
Gene Name | GTF2F1 |
---|
Gene Id | 505702 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Negative DNA supercoiling partially compensates for the defects of TFIIF mutants in initiation, indicating that TFIIF may help to untwist the DNA helix for initiation. |
---|
Biochemical Properties | Single amino acid substitutions at hydrophobic residues L155, W164, I176, and M177 have similar activity to RAP74(1-158). |
---|
PTMs | N6-Acetylation at Lys, Phosphorylation at Ser/Thr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5EA53|T2FA_BOVIN General transcription factor IIF subunit 1 OS=Bos taurus OX=9913 GN=GTF2F1 PE=2 SV=1
MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNLTTWNQARLERDLSNKKIYQEE
EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTSYYIFTQCPDGAFEAFPVHNWYNFTPLAKHRTLT*156AEEAEEEWERRNKVLNHFSIMQQR
RLKDQDQDEEDEEKEKRSRKKASELRIHDLEDDLEMS*217S*218DDS*221EAS*224GEEGGRAPKAKKKAPPSKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQDELEGKPKATQQEEGPKG
VDEQSESSEESEEEKPPEEDKEEEEEKKAPT*331PQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPS*377GGS*380S*381RGNS*385RPGT*389PS*391TEAGSTSSTLRAAASKLEQGKRTSETPAAKRLRLDTGPQS*431LS*433GKS*436T*437PQPQSGKST*446PSS*449GDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
|
---|
Predicted Disorder Regions | 3-14, 57-76, 107-114, 154-481 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | Mutagenic analysis shows that the N-terminal region of RAP74 between L155 (leucine at codon 155) and M177 is important for initiation. Mutants in this region have reduced activity in transcription, but none are inactive. |
---|
Bibliography | 1.Ren D, Lei L, Burton ZF. A region within the RAP74 subunit of human transcription factor IIF is critical for initiation but dispensable for complex assembly. Mol Cell Biol. 1999 Nov;19(11):7377-87. doi: 10.1128/MCB.19.11.7377. PMID: 10523626; PMCID: PMC84731. 2.Ren D, Lei L, Burton ZF. A region within the RAP74 subunit of human transcription factor IIF is critical for initiation but dispensable for complex assembly. Mol Cell Biol. 1999 Nov;19(11):7377-87. doi: 10.1128/MCB.19.11.7377. PMID: 10523626; PMCID: PMC84731. |