Search by BoMiProt ID - Bomi5974


Primary Information

BoMiProt ID Bomi5974
Protein Name General transcription factor IIF subunit 1/Transcription initiation factor IIF subunit alpha/TFIIF-alpha
Organism Bos taurus
Uniprot IdQ5EA53
Milk FractionWhey
Ref Sequence Id NP_001015527.1
Aminoacid Length 517
Molecular Weight 58262
Fasta Sequence https://www.uniprot.org/uniprot/Q5EA53.fasta
Gene Name GTF2F1
Gene Id 505702
Protein Existence Status reviewed

Secondary Information

Protein Function Negative DNA supercoiling partially compensates for the defects of TFIIF mutants in initiation, indicating that TFIIF may help to untwist the DNA helix for initiation.
Biochemical Properties Single amino acid substitutions at hydrophobic residues L155, W164, I176, and M177 have similar activity to RAP74(1-158).
PTMs N6-Acetylation at Lys, Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5EA53|T2FA_BOVIN General transcription factor IIF subunit 1 OS=Bos taurus OX=9913 GN=GTF2F1 PE=2 SV=1 MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNLTTWNQARLERDLSNKKIYQEE EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE NTSYYIFTQCPDGAFEAFPVHNWYNFTPLAKHRTLT*156AEEAEEEWERRNKVLNHFSIMQQR RLKDQDQDEEDEEKEKRSRKKASELRIHDLEDDLEMS*217S*218DDS*221EAS*224GEEGGRAPKAKKKAPPSKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQDELEGKPKATQQEEGPKG VDEQSESSEESEEEKPPEEDKEEEEEKKAPT*331PQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPS*377GGS*380S*381RGNS*385RPGT*389PS*391TEAGSTSSTLRAAASKLEQGKRTSETPAAKRLRLDTGPQS*431LS*433GKS*436T*437PQPQSGKST*446PSS*449GDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Predicted Disorder Regions 3-14, 57-76, 107-114, 154-481
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Mutagenic analysis shows that the N-terminal region of RAP74 between L155 (leucine at codon 155) and M177 is important for initiation. Mutants in this region have reduced activity in transcription, but none are inactive. 
Bibliography 1.Ren D, Lei L, Burton ZF. A region within the RAP74 subunit of human transcription factor IIF is critical for initiation but dispensable for complex assembly. Mol Cell Biol. 1999 Nov;19(11):7377-87. doi: 10.1128/MCB.19.11.7377. PMID: 10523626; PMCID: PMC84731. 2.Ren D, Lei L, Burton ZF. A region within the RAP74 subunit of human transcription factor IIF is critical for initiation but dispensable for complex assembly. Mol Cell Biol. 1999 Nov;19(11):7377-87. doi: 10.1128/MCB.19.11.7377. PMID: 10523626; PMCID: PMC84731.