Search by BoMiProt ID - Bomi5973


Primary Information

BoMiProt ID Bomi5973
Protein Name General transcription factor IIE subunit 1/Transcription initiation factor IIE subunit alpha/TFIIE-alpha
Organism Bos taurus
Uniprot IdA6QLI8
Milk FractionWhey
Ref Sequence Id NP_001096764.1
Aminoacid Length 438
Molecular Weight 49211
Fasta Sequence https://www.uniprot.org/uniprot/A6QLI8.fasta
Gene Name GTF2E1
Gene Id 540525
Protein Existence Status reviewed

Secondary Information

Protein Function TFIIE helps in the recruitment of TFII regulates TFIIH kinase activity that phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II.
Biochemical Properties TFIIE binds Gal11 protein, a component of the Mediator, and that TFIIE-Gal11 interaction en-hances TFIIH-catalyzed phosphorylation of the CTD.
PTMs Acetylation Ala and Lys and phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLI8|T2EA_BOVIN General transcription factor IIE subunit 1 OS=Bos taurus OX=9913 GN=GTF2E1 PE=2 SV=1 MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNPCVKEEDMLELLKFDRKQLR SVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERD STNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCQTEVEEDESAMPKKDARTLLARF NEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDRAATAAGAAGLAGGHHREAWT TKGPSYEDLYTQNVVINMDDQEDLHRAS*268LEGKSAKERPIWLRESTVQGAYNSEEMKEGGI DIDSFQEHEEGHAGPDDNEEVMRALLIHEKKTPSAPAGSVGAAAPVTAANGSDSESETSE SDDDSPPRVATVAAHHGEEDEEDDEFEEVADDPVVMVAGRPFSYSEVSQKPELVAQMTPE EKEAYIAMGQRMFEDLFE
Predicted Disorder Regions 215-251, 261-410, 419-423,
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Sakurai H, Fukasawa T. Activator-specific requirement for the general transcription factor IIE in yeast. Biochem Biophys Res Commun. 1999 Aug 11;261(3):734-9. doi: 10.1006/bbrc.1999.1113. PMID: 10441494.