Search by BoMiProt ID - Bomi5971


Primary Information

BoMiProt ID Bomi5971
Protein Name General transcription and DNA repair factor IIH helicase subunit XPB/TFIIH subunit XPB/DNA excision repair protein ERCC-3
Organism Bos taurus
Uniprot IdQ1RMT1
Milk FractionWhey
Ref Sequence Id NP_001039453.1
Aminoacid Length 782
Molecular Weight 89193
Fasta Sequence https://www.uniprot.org/uniprot/Q1RMT1.fasta
Gene Name ERCC3
Gene Id 507984
Protein Existence Status reviewed

Secondary Information

Protein Function involved in transcription-coupled nucleotide excision repair (NER) of damaged DNA.ATP-dependent 3'-5' DNA helicase,component of the general transcription and DNA repair factor IIH (TFIIH) core complex.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1RMT1|ERCC3_BOVIN General transcription and DNA repair factor IIH helicase subunit XPB OS=Bos taurus OX=9913 GN=ERCC3 PE=2 SV=1 MGKRDRADREKKKSKKRHYEDEEDEEDDAPGNDTQEAVPSAAGKQVDESGTKVDEYGAKD YRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA YSLYAAVSVGLQTSDITDYLRKLSKTGVPEGIIQFIKLCTVSYGKVKLVLKHNRYFVESS HPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAIAKSVEGSGGPSTSRVTDPQG KSDIPTDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKR CLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSIAISTYSMLGHTTKRS WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL NFLIGPKLYEANWMELQNSGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNK FRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFY SLVSQDTQEMAYSTKRQRFLVDQGYS*686FKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT DLDAEEEVVAGEFGSKSSQVSRRFGTMSSMSGADDTVYMEYHSSRSKTSTKHVHPLFKRF RK
Predicted Disorder Regions 1-58, 205-268, 768-777
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.
Bibliography Hubank M, Mayne L. Expression of the excision repair gene, ERCC3 (excision repair cross-complementing), during mouse development. Brain Res Dev Brain Res. 1994 Aug 12;81(1):66-76. doi: 10.1016/0165-3806(94)90069-8. PMID: 7805288.