Search by BoMiProt ID - Bomi5940


Primary Information

BoMiProt ID Bomi5940
Protein Name Gap junction gamma-2 protein/Gap junction alpha-12 protein
Organism Bos taurus
Uniprot IdQ29RK8
Milk FractionWhey
Ref Sequence Id NP_001039905.1
Aminoacid Length 429
Molecular Weight 46067
Fasta Sequence https://www.uniprot.org/uniprot/Q29RK8.fasta
Gene Name GJC2/GJA12
Gene Id 538745
Protein Existence Status reviewed

Secondary Information

Protein Function cell to cell diffusion of ions and molecules through this channel.Cx47 (Gja12) is expressed specifically in oligodendrocytes and that its expression is regulated in parallel with other myelin genes.
Biochemical Properties A connexon is composed of a hexamer of connexins.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RK8|CXG2_BOVIN Gap junction gamma-2 protein OS=Bos taurus OX=9913 GN=GJC2 PE=2 SV=1 MTNMSWSFLTRLLEEIHNHSTFVGKVWLTVLVVFRIVLTAVGGESIYSDEQTKFTCNTRQ PGCDNVCYDAFAPLSHVRFWVFQIVVISTPSVMYLGYAVHRLARASQDERRRASRRRPSR RAPRPPLPLPPPPHPGWPEPADLGEEEPMLGLGEEDEDPGVAEGLGEDEEAEDTGAAKGA GGDTKVAGVPGPAGQHDGRRRIQREGLMRVYVAQLVARAAFEVAFLVGQYLLYGFEVRPF FACSRQPCPHVVDCFVSRPTEKTVFLLVMYVVSCLCLLLNLCEMAHLGLGNAQDAVRGRR PLPASPGPMPRPPPCALPAAPSGLACPPDYSLVVRTAEHARAQDQELASLALQALQDRRA LGDLDS*366PPGPGLPANARGPPKPGAPASGSGSATSGGTVGGQGRQGIKPRMGSEKGSGSSS REGKTTVWI
Predicted Disorder Regions 5 disordered segments; (110-173), (297-328), (353-370), (388-395), (406-428)
DisProt Annotation
TM Helix Prediction 4TMHs; (21-43),(79-97),(210-232),(263-281)
Additional Comments Inborn errors of brain myelin formation or hypomyelinating leukodystrophies (HLD) due to mutation of this gene
Bibliography Boespflug-Tanguy O. Inborn errors of brain myelin formation. Handb Clin Neurol. 2013;113:1581-92. doi: 10.1016/B978-0-444-59565-2.00027-7. PMID: 23622380.