Search by BoMiProt ID - Bomi5933


Primary Information

BoMiProt ID Bomi5933
Protein Name Gamma-glutamylcyclotransferase
Organism Bos taurus
Uniprot IdQ32LE4
Milk FractionWhey,MFGM
Ref Sequence Id NP_001032699.1
Aminoacid Length 188
Molecular Weight 21177
Fasta Sequence https://www.uniprot.org/uniprot/Q32LE4.fasta
Gene Name GGCT
Gene Id 533374
Protein Existence Status reviewed

Secondary Information

Protein Function is involved in glutathione (GSH) degradation and involved in aminoacid transport through plasma membrane.
Biochemical Properties Catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis., extracellular GSH can be hydrolysed by membrane-bound c-glutamyl transpeptidase (GGT) to cysteinyl-glycine and c-glutamyl–amino acid dipeptide.L cysteine is the acceptor for GGT.
Significance in milk glutathione metabolism
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32LE4|GGCT_BOVIN Gamma-glutamylcyclotransferase OS=Bos taurus OX=9913 GN=GGCT PE=2 SV=1 MANFGCEDLRSQDGESFLYFAYGSNLLTERIHLRNPSAVFYSVARLQDFKLDFGNPQGKT SETWHGGIATIFESPGDEVWGVVWKMNKSNLSSLDKQEGVKSGMYVPIEVTVSTQEGKEI TCRSYQMTNYESVPPSPQYKKVICMGAKENGLPLEYQKKLNSIEPNDYKGKVS*173EEIEDII KKGEAKTH
Predicted Disorder Regions 1-10, 155-158, 164-188
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography He Z, Sun X, Wang S, Bai D, Zhao X, Han Y, Hao P, Liu XS. Ggct (γ-glutamyl cyclotransferase) plays an important role in erythrocyte antioxidant defense and red blood cell survival. Br J Haematol. 2021 Oct;195(2):267-275. doi: 10.1111/bjh.17775. Epub 2021 Aug 18. PMID: 34409610.