Primary Information |
---|
BoMiProt ID | Bomi5933 |
---|
Protein Name | Gamma-glutamylcyclotransferase |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q32LE4 |
---|
Milk Fraction | Whey,MFGM |
---|
Ref Sequence ID | NP_001032699.1 |
---|
Aminoacid Length | 188 |
---|
Molecular Weight | 21177 |
---|
FASTA Sequence |
Download |
---|
Gene Name | GGCT |
---|
Gene ID | 533374 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | is involved in glutathione (GSH) degradation and involved in aminoacid transport through plasma membrane. |
---|
Biochemical Properties | Catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis., extracellular GSH can be hydrolysed by membrane-bound c-glutamyl transpeptidase (GGT) to cysteinyl-glycine and c-glutamyl–amino acid dipeptide.L cysteine is the acceptor for GGT. |
---|
Significance in milk | glutathione metabolism |
---|
PTMs | Phosphorylation on Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32LE4|GGCT_BOVIN Gamma-glutamylcyclotransferase OS=Bos taurus OX=9913 GN=GGCT PE=2 SV=1
MANFGCEDLRSQDGESFLYFAYGSNLLTERIHLRNPSAVFYSVARLQDFKLDFGNPQGKT
SETWHGGIATIFESPGDEVWGVVWKMNKSNLSSLDKQEGVKSGMYVPIEVTVSTQEGKEI
TCRSYQMTNYESVPPSPQYKKVICMGAKENGLPLEYQKKLNSIEPNDYKGKVS*173EEIEDII
KKGEAKTH |
---|
Predicted Disorder Regions | 1-10, 155-158, 164-188 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | He Z, Sun X, Wang S, Bai D, Zhao X, Han Y, Hao P, Liu XS. Ggct (γ-glutamyl cyclotransferase) plays an important role in erythrocyte antioxidant defense and red blood cell survival. Br J Haematol. 2021 Oct;195(2):267-275. doi: 10.1111/bjh.17775. Epub 2021 Aug 18. PMID: 34409610. |