Search by BoMiProt ID - Bomi5930


Primary Information

BoMiProt ID Bomi5930
Protein Name Gamma-aminobutyric acid receptor subunit alpha-3/GABA(A) receptor subunit alpha-3
Organism Bos taurus
Uniprot IdP10064
Milk FractionWhey
Ref Sequence Id NP_776967.1
Aminoacid Length 492
Molecular Weight 55284
Fasta Sequence https://www.uniprot.org/uniprot/P10064.fasta
Gene Name GABRA3
Gene Id 282237
Protein Existence Status reviewed

Secondary Information

Protein Function Gamma-aminobutyric acid (GABA) receptors
Biochemical Properties heteromeric pentameric ligand-gated ion channels
PTMs Phosphorylation.Glycosylation,Disulfide bond formation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P10064|GBRA3_BOVIN Gamma-aminobutyric acid receptor subunit alpha-3 OS=Bos taurus OX=9913 GN=GABRA3 PE=2 SV=1 MIITQMSQFYMAGLGLLFLINILPGTTGQVESRRQEPGDFVKQDIGGLSPKHAPDIPDDS TDN*63ITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHN*163MTTPNKLLRLVDN*176GTLL YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKN*228KSVEVAQDGSRL NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFMAVCYAFVFSALIEFATVN YFTKRSWAWEGKKVPEALEMKKKTPAVPTKKTSTTFNIVGTTYPINLAKDTEFSAISKGA APSTSS*226T*227PTIIAS*233PKTTCVQDIPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN RESAIKGMIRKQ
Predicted Disorder Regions 29-61
DisProt Annotation
TM Helix Prediction 5TMHs; (7-25, (275-297), (304-325), (340-362), (461-479)
Significance of PTMs phosphorylation sites located on the cytoplasmic domain between TM3 and TM4 of the α, β, and γ subunits
Additional Comments Gabra3 promotes breast cancer invasion and metastasis
Bibliography Gumireddy K, Li A, Kossenkov AV, Sakurai M, Yan J, Li Y, Xu H, Wang J, Zhang PJ, Zhang L, Showe LC, Nishikura K, Huang Q. The mRNA-edited form of GABRA3 suppresses GABRA3-mediated Akt activation and breast cancer metastasis. Nat Commun. 2016 Feb 12;7:10715. doi: 10.1038/ncomms10715. PMID: 26869349; PMCID: PMC4754346.