Search by BoMiProt ID - Bomi5926


Primary Information

BoMiProt ID Bomi5926
Protein Name Galectin-3-binding protein
Organism Bos taurus
Uniprot IdA7E3W2
Milk FractionWhey
Ref Sequence Id NP_001039781.1
Aminoacid Length 555
Molecular Weight 62127
Fasta Sequence https://www.uniprot.org/uniprot/A7E3W2.fasta
Gene Name LGALS3BP
Gene Id 531137
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells found in most normal adult tissues, mainly in epithelial and myeloid/amoeboid cells.
Protein Function Promotes integrin-mediated cell adhesion.stimulate host defense against viruses and tumor cells.Gal-3BP can induce galectin-mediated tumor cell aggregation to increase the survival of cancer cells in the bloodstream during the metastatic process.
Biochemical Properties Homodimers and homomultimers.Interacts with the gamma-tubulin ring complex.
Significance in milk related to cow milk allergy in children
PTMs N linked Glycosylation on Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7E3W2|LG3BP_BOVIN Galectin-3-binding protein OS=Bos taurus OX=9913 GN=LGALS3BP PE=1 SV=1 MAPLRLFWIWLLVVGTRGVKDGDMRLADGGSANQGRVEIYYNGQWGTVCENMWDLTDASV VCRALGFQN*69ATEALGGAAFGPGYGPIMLDEVRCTGTEPSLANCSSLGWMRSNCRHDKDAS VICTN*125ETRGVYTLDLSGELPAALEQIFESQKGCDLFITVKVREEDEIAMCAHKLILSTNP EAHGLWKEPGSRVTMEVDAECVPVVKDFIRYLYSRRIDVSLSSVKCLHKLASAYQAKQLQ SYCGHLFAILIPQDPSFWTPLELYAYALATRDPVLEEICVQFLAWNFGALTQAEAWPSVP PALLQGLLSRTELVVPSELVLLLAVDKWSQERRTSHKEVEALVGQVRFPMMPPQDLFSLQ FN*362LSLYWSHEALFQKKILQALEFHTVPFELLAQYWGLN*398LTEGTYQPRLYTSPTWSQSVMS SSYNPSRSFQTPQHPSFLFHDSSVSWSFVYLPTLQSCWNYGFSCSSDDPPLLALSKSSYS KSNPTIGYENRALLHCEGSFVVDVIDFKGWKALVPSALATNSSRSTSLFPCPSGVFSRFQ VVIRPFYLTN*550STDMD
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Lin TW, Chang HT, Chen CH, Chen CH, Lin SW, Hsu TL, Wong CH. Galectin-3 Binding Protein and Galectin-1 Interaction in Breast Cancer Cell Aggregation and Metastasis. J Am Chem Soc. 2015 Aug 5;137(30):9685-93. doi: 10.1021/jacs.5b04744. Epub 2015 Jul 22. PMID: 26168351.