Search by BoMiProt ID - Bomi5922


Primary Information

BoMiProt ID Bomi5922
Protein Name Galactosylceramide sulfotransferase/GalCer sulfotransferase/3'-phosphoadenosine-5'-phosphosulfate:GalCer sulfotransferase/3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase/Cerebroside sulfotransferase
Organism Bos taurus
Uniprot IdA6QNK1
Milk FractionWhey,MFGM
Ref Sequence Id NP_001095442.1
Aminoacid Length 423
Molecular Weight 48754
Fasta Sequence https://www.uniprot.org/uniprot/A6QNK1.fasta
Gene Name GAL3ST1
Gene Id 513295
Protein Existence Status reviewed

Secondary Information

Protein Function Involved in the development of cerebrum and cerebellum of mice.Catalyzes the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes.
Biochemical Properties This protein is involved in the pathway sphingolipid metabolism, which is part of Lipid metabolism.
Significance in milk biosynthesis of sulfated glycans
PTMs N-linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QNK1|G3ST1_BOVIN Galactosylceramide sulfotransferase OS=Bos taurus OX=9913 GN=GAL3ST1 PE=2 SV=1 MPLPQKKRWESMAKGLVLGALFTSFLLLLYSYAVPPLYTGLASTTPEGAAPCSPAPREPE APTSAN*66GSAGGCQPRRDIVFMKTHKTASSTLLNILFRFGQKHGLKFAFPNGRNDFDYPAF FARSLVQDYRPGACFNIICNHMRFHYDEVRGLVAPN*156ATFITVLRDPARLFESSFHYFGSV VPFTWKLSGRDKLAEFLQDPDRYYDARGYNAHYLRNLLFFDLGYDSDLDPSSPQVQEHIL EVERHFHLVLLQEYFDESLVLLKDLLCWELEDVLYFKLNARRASAVPRLSGELYRRATAW NVLDARLYRHFN*312ASFWRKVEAFGRERMAREVAALRRANERMRRICIDGGRAVDAAAIEDS AMQPWQPLGAKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWITKLWKFIRDF LRW
Predicted Disorder Regions (46-71)
DisProt Annotation
TM Helix Prediction 1TMH; (13-35)
Significance of PTMs glycosylation has been found to be required for the correct subcellular targeting of some proteins, for the stabilization of enzymes, or to be directly involved in forming an active enzyme.
Additional Comments The formation of sulphatide and seminolipid by the transfer of sulphate from adenosine 3-phosphate 5-phosphosulphate (PAPS) to galactocerebroside and galactosylalkylacylglycerol respectively is catalysed by the same enzyme, galactosylceramide sulphotransferase (CST), a Golgi type II membrane protein
Bibliography 1.Eckhardt M, Fewou SN, Ackermann I, Gieselmann V. N-glycosylation is required for full enzymic activity of the murine galactosylceramide sulphotransferase. Biochem J. 2002 Nov 15;368(Pt 1):317-24. doi: 10.1042/BJ20020946. PMID: 12175333; PMCID: PMC1222978. 2.Burkart T, Wiesmann UN, Siegrist HP, Herschkowitz NN. Net sulfatide synthesis, galactosylceramide sulfotransferase and arylsulfatase A activity in the developing cerebrum and cerebellum of normal mice and myelin-deficient jimpy mice. Biochim Biophys Acta. 1981 Mar 18;673(3):351-8. doi: 10.1016/0304-4165(81)90466-9. PMID: 6112019. 3.Varki, A. (1993) Biological roles of oligosaccharides : all of the theories are correct. Glycobiology 3, 97–130.