Search by BoMiProt ID - Bomi5917


Primary Information

BoMiProt ID Bomi5917
Protein Name G2/mitotic-specific cyclin-B1
Organism Bos taurus
Uniprot IdQ1LZG6
Milk Fractionwhey
Ref Sequence Id NP_001039337.1
Aminoacid Length 427
Molecular Weight 47658
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZG6.fasta
Gene Name CCNB1
Gene Id 327679
Protein Existence Status Reviewed

Secondary Information

Protein Function It is essential for the control of the cell cycle at the G2/M (mitosis) transition.
PTMs Acetylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZG6|CCNB1_BOVIN G2/mitotic-specific cyclin-B1 OS=Bos taurus OX=9913 GN=CCNB1 PE=2 SV=1 MALRITRNTKISAENKAKISMAGAKRVPVAAVATSKPGLRPRTALGDIGNKVSEQPQAKL PLKKEAKTLASGKVTAKKVPKPLEKAPVPVPEPQPEPEPEPEHVKEDKLSPEPILVDTPS*120 PS*122PMETS*127GCAPAEEYLCQAFS*141DVILAVSDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQA VKPKYLMGREVTGNMRAILIDWLVQVQIKFRLLQETMYMTVSIIDRFMQDTYVPKKMLQL VGVTAMFVASKYEEMYPPEIGDFAFVTDNTYTKFQIRQMEMKILRALNFSLGRPLPLHFL RRASKIGEVDVELHT*315LAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKVLDNGEWTPTLQ HYLSYTEESLLVVMQHLAKNVVMVNRGLTKHMTIKNKYATSKHAKISTLAQLNSALVQDL AKAVAKV
Predicted Disorder Regions 1-134
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated by PLK1 at Ser-127 on centrosomes during prophase: phosphorylation by PLK1 does not cause nuclear import.
Bibliography Ye, Q., Lei, L., & Aili, A. X. (2015). Identification of potential targets for ovarian cancer treatment by systematic bioinformatics analysis. European journal of gynaecological oncology, 36(3), 283–289.