Search by BoMiProt ID - Bomi5900


Primary Information

BoMiProt ID Bomi5900
Protein Name G protein-coupled receptor 161
Organism Bos taurus
Uniprot IdQ2YDN1
Milk FractionWhey
Ref Sequence Id NP_001070534.1
Aminoacid Length 528
Molecular Weight 58349
Fasta Sequence https://www.uniprot.org/uniprot/Q2YDN1.fasta
Gene Name GPR161
Gene Id 768006
Protein Existence Status reviewed

Secondary Information

Protein Function acts as a Gαs-coupled receptor and activates PKA, a central negative regulator of Hh signaling
Biochemical Properties AKAP motif embedded in its C-terminal tail
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2YDN1|GP161_BOVIN G protein-coupled receptor 161 OS=Bos taurus OX=9913 GN=GPR161 PE=2 SV=1 MSLN*4SSLGHRKELSN*15LTEGASDQGGSGVTEFVAIVIITVFVCLGNLVIVITLYRKSYLLT LSNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCN*101FSALLYLLISSASMLTLGI IAVDRYYAVLYPMAYPMKITGNRAVMVLAYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVA AWHREPGYTAFWQIWCALLPFLVMLVCYGFIFRVARVKARKVHCGAVVTVEVGVQRTGRK NSSTSTSSSGSRKSAFQGVVYSANQCKALVTILVVIGAFMVTWGPYMVVITSEALWGKNC VSPTLETWATWLSFTSAICHPLIYGLWNKTVRKELLGMCFGDRYYREPFVQRQRTSRLFS ISNRITDLGLSPHLTALMAGEQPLGNSSSTGDTGFSCSQDSGTDVMLLEDYTSDDNPLHG TCPPKRRSSVTFEDEVEQIKEAAKNPILHVKADVHKSLDSYATSLAKAIEAEAKINLFGE EALPGVLLTARTVPGIGFGSRRGSRTLAGQRLQLQSIEEGDVLATEQR
Predicted Disorder Regions 1-20, 240-249, 379-442, 520-527
DisProt Annotation
TM Helix Prediction 7TMHs; (31-53),(66-84),(93-123),(144-166),(190-212),(268-290),(309-327)
Significance of PTMs Gpr161 is phosphorylated by PKA at the PKA consensus site position RRSS429 which is imp for GPCR-cAMP signaling.
Bibliography 1.Bachmann VA, Mayrhofer JE, Ilouz R, Tschaikner P, Raffeiner P, Röck R, Courcelles M, Apelt F, Lu TW, Baillie GS, Thibault P, Aanstad P, Stelzl U, Taylor SS, Stefan E. Gpr161 anchoring of PKA consolidates GPCR and cAMP signaling. Proc Natl Acad Sci U S A. 2016 Jul 12;113(28):7786-91. doi: 10.1073/pnas.1608061113. Epub 2016 Jun 28. PMID: 27357676; PMCID: PMC4948347.