Search by BoMiProt ID - Bomi5882


Primary Information

BoMiProt ID Bomi5882
Protein Name G patch domain-containing protein 4
Organism Bos taurus
Uniprot IdQ2KJE1
Milk FractionWhey
Ref Sequence Id NP_001071597.1
Aminoacid Length 408
Molecular Weight 46797
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJE1.fasta
Gene Name GPATCH4/GPATC4
Gene Id 768314
Protein Existence Status reviewed

Secondary Information

Protein Function G4 localizes to both the nucleolus and the Cajal body. involved in the regulation of cell growth and nucleolar structure.
Biochemical Properties contains a RNA binding motif,a G pathch domain which is imp for its localization in nucleolus and rRNA association.. The C-terminal region between amino acids 300 and 446 also contains many lysines and arginines. These basic amino acids contribute to the nucleolar localization of G4.
PTMs Acetylation, Isopeptide bond, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJE1|GPTC4_BOVIN G patch domain-containing protein 4 OS=Bos taurus OX=9913 GN=GPATCH4 PE=2 SV=1 MSIT*4PEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTYGVGHDPAKEF TNHWWNDLFNKTAANLVVETRQDGVQIRRLSKETTRQDHAKPNLLYQKFVKTATLT*116SSGE KPDKDWES*128CS*130DDDSQEPKPPNVLTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQA FLAQLKGQDPGVPQLQSESKSPKKKKKKRKQKEEEEPTTTERSAEKYSEHTDESIRKSKK KKRQHQEERVTDEREGTAIENEEETIRTGGLGELKNREHVDRSFRKKKRRGQHHEERAEL AVLDNEGGKVAVSEVGTEEAERRVYTHPCGRSKKRRQHEEEDLNTEDEEVEEALVDSGTR EAESRSCSDQKRGRSKKKRRQYQEEEVLDGPGVNTAQKAKKKKQKKRD
Predicted Disorder Regions 3-59, 88-408
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments G4 knockdown also decreased the number of fibrillar center and dense fibrillar component regions inside the nucleolus.
Bibliography 1.Hirawake-Mogi H, Thanh Nhan NT, Okuwaki M. G-patch domain-containing protein 4 localizes to both the nucleoli and Cajal bodies and regulates cell growth and nucleolar structure. Biochem Biophys Res Commun. 2021 Jun 25;559:99-105. doi: 10.1016/j.bbrc.2021.04.026. Epub 2021 Apr 30. PMID: 33933995. 2.Hirawake-Mogi H, Thanh Nhan NT, Okuwaki M. G-patch domain-containing protein 4 localizes to both the nucleoli and Cajal bodies and regulates cell growth and nucleolar structure. Biochem Biophys Res Commun. 2021 Jun 25;559:99-105. doi: 10.1016/j.bbrc.2021.04.026. Epub 2021 Apr 30. PMID: 33933995.