Search by BoMiProt ID - Bomi5881


Primary Information

BoMiProt ID Bomi5881
Protein Name G patch domain-containing protein 1
Organism Bos taurus
Uniprot IdQ24K12
Milk FractionWhey
Ref Sequence Id NP_001069246.1
Aminoacid Length 931
Molecular Weight 103602
Fasta Sequence https://www.uniprot.org/uniprot/Q24K12.fasta
Gene Name GPATCH1/GPATC1
Gene Id 518738
Protein Existence Status reviewed

Secondary Information

Protein Function SUGP1 acts as a novel regulator of cholesterol metabolism and suggest that it contributes to the relationship between rs10401969 and plasma cholesterol.
Biochemical Properties The SUGP1 protein is predicted to contain two SURP motifs, domains of alternative splicing regulators thought to be involved in RNA binding as well as a G-patch domain, a region of six highly conserved glycine residues commonly found in eukaryotic RNA-processing proteins
PTMs Acetylation at Ala, Isopeptide bond formation, Phosphorylation at Ser, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q24K12|GPTC1_BOVIN G patch domain-containing protein 1 OS=Bos taurus OX=9913 GN=GPATCH1 PE=2 SV=1 MAALDS*6DS*8DEDLVSYGTGLEPLEEGERPKKPIPLQDQTVRDEKGRYKRFHGAFSGGFSAG YFNTVGSKEGWTPSSFVSSRQNRADKSVLGPEDFMDEEDLSEFGIAPKSIVTTDDFASKT KDRIREKARQLAAATAPIPGATLLDDLITPAKLSVGFELLRKMGWKEGQGIGPRVKRRPR RQKPDPGVKIYGCALPPGGSEGSEDEDDDYLPENVTFAPKDVTPVDFTPKDNVHGLAYKG LDPHQALFGTSGEHFNLFSGGPEETGDLLGDIGVNKGRKLGISGQAFGVGALEEEDDDIY ATETLSKYDTVLKDEEPGDGLYGWTAPRQYKSQKESEKDLCYVGKILDGFSLASKPLS*358SK KIYPPPELPRDYRPVHYFRPVVAATSENSHLLQVLSESAGKPTNDPGTRSRHQLNACKRG ELLGETPIQGAPTSVLEFLSQKDKERLKEVKQATDLKAAQLRARSLAQSASGSRPQPLS*479P DVGHCSWHMALSGGMASTRTSNFKPFAKDPEKQKRYEEFLANMKRGQKDALERCLDPGMT EWERGRERDEFARAALLYASSHSTLSSRFTHAQEEDDSEQVEVPRDQENDVSDKQSAVKM KMFGKLTRDTFEWHPDKLLCKRFNVPDPYPDSTLVGLPRVKRDKYSVFNFLTIPETASSP VTQASSEKVAQHRASDKSRKPSRWDTSKEEKKEDSISEFLSLARSKVGPAKPEPS*715PLVNK EEARATESVSNKVVNKDVDSQTEGEGSRPSMDLFKAIFASSSDEKSSSSEDEQGDSEDDQ EGTREADFKSSQETDLVEASSVAQASEPAPQEPAPFFPIQKMQIDEREAFGPRLPPVFCP NARQKLEAPLKEKHKKNKEKHKTKKEHRRKKEKKKKHRKHKHKGKQKNKKSEKSSSSEST DSSDSQSEEGPTDLSPQELLRRLKRLPLRRQ
Predicted Disorder Regions 142-173, 558-580, 634-715, 746-822, 856-931
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments G patch domain containing 1 (SUGP1) is associated with coronary artery disease (CAD), plasma LDL cholesterol levels, and other energy metabolism phenotypes. 
Bibliography 1.Kim MJ, Yu CY, Theusch E, Naidoo D, Stevens K, Kuang YL, Schuetz E, Chaudhry AS, Medina MW. SUGP1 is a novel regulator of cholesterol metabolism. Hum Mol Genet. 2016 Jul 15;25(14):3106-3116. doi: 10.1093/hmg/ddw151. Epub 2016 May 20. PMID: 27206982; PMCID: PMC5181593. 2.SWAP pre-mRNA splicing regulators are a novel, ancient protein family sharing a highly conserved sequence motif with the prp21 family of constitutive splicing proteins. 3.G-patch: a new conserved domain in eukaryotic RNA-processing proteins and type D retroviral polyproteins. Aravind L, Koonin EV Trends Biochem Sci. 1999 Sep; 24(9):342-4. Spikes DA, Kramer J, Bingham PM, Van Doren K Nucleic Acids Res. 1994 Oct 25; 22(21):4510-9. 3.