Primary Information |
---|
BoMiProt ID | Bomi5872 |
---|
Protein Name | FXYD domain-containing ion transport regulator 7 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q3ZBJ3 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001032716.1 |
---|
Aminoacid Length | 78 |
---|
Molecular Weight | 8352 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q3ZBJ3.fasta |
---|
Gene Name | FXYD7 |
---|
Gene Id | 616128 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | brain-specific,Shows sodium channel regulator activity. involved in endoplasmic reticulum export, association with and regulation of Na,K-ATPase |
---|
PTMs | Phosphorylation on Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBJ3|FXYD7_BOVIN FXYD domain-containing ion transport regulator 7 OS=Bos taurus OX=9913 GN=FXYD7 PE=3 SV=1
MATQVPTKVPQDPDPFYYDYDTVQTVGMTLATILFLLGILIILSKKVKCRKADSRSESPT
CKSCKSELPSS*71APGGGGV |
---|
Predicted Disorder Regions | 2 disordered segments;(1-15), (43-78) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 1TMH ; (22-44) |
---|
Bibliography | Crambert G, Li C, Swee LK, Geering K. FXYD7, mapping of functional sites involved in endoplasmic reticulum export, association with and regulation of Na,K-ATPase. J Biol Chem. 2004 Jul 16;279(29):30888-95. doi: 10.1074/jbc.M313494200. Epub 2004 May 7. PMID: 15133029. |