Search by BoMiProt ID - Bomi5872


Primary Information

BoMiProt ID Bomi5872
Protein Name FXYD domain-containing ion transport regulator 7
Organism Bos taurus
Uniprot IdQ3ZBJ3
Milk FractionWhey
Ref Sequence Id NP_001032716.1
Aminoacid Length 78
Molecular Weight 8352
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBJ3.fasta
Gene Name FXYD7
Gene Id 616128
Protein Existence Status reviewed

Secondary Information

Protein Function brain-specific,Shows sodium channel regulator activity. involved in endoplasmic reticulum export, association with and regulation of Na,K-ATPase
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBJ3|FXYD7_BOVIN FXYD domain-containing ion transport regulator 7 OS=Bos taurus OX=9913 GN=FXYD7 PE=3 SV=1 MATQVPTKVPQDPDPFYYDYDTVQTVGMTLATILFLLGILIILSKKVKCRKADSRSESPT CKSCKSELPSS*71APGGGGV
Predicted Disorder Regions 2 disordered segments;(1-15), (43-78)
DisProt Annotation
TM Helix Prediction 1TMH ; (22-44)
Bibliography Crambert G, Li C, Swee LK, Geering K. FXYD7, mapping of functional sites involved in endoplasmic reticulum export, association with and regulation of Na,K-ATPase. J Biol Chem. 2004 Jul 16;279(29):30888-95. doi: 10.1074/jbc.M313494200. Epub 2004 May 7. PMID: 15133029.