Search by BoMiProt ID - Bomi5864


Primary Information

BoMiProt ID Bomi5864
Protein Name Fructose-bisphosphate aldolase B/Liver-type aldolase
Organism Bos taurus
Uniprot IdQ3T0S5
Milk FractionWhey,MFGM
Ref Sequence Id NP_001029657.1
Aminoacid Length 364
Molecular Weight 39543
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0S5.fasta
Gene Name ALDOB
Gene Id 515263
Protein Existence Status reviewed

Secondary Information

Protein Function involved in glucose and fructose metabolism.negative regulation of Akt activation thus inhibiting hepatic carcinogenesis.Aldob directly binds and inhibits the rate-limiting enzyme in pentose phosphate pathway (PPP), glucose-6-phosphate dehydrogenase (G6PD)
Biochemical Properties tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0S5|ALDOB_BOVIN Fructose-bisphosphate aldolase B OS=Bos taurus OX=9913 GN=ALDOB PE=2 SV=1 MAHQFPALTSEQKKALSETARRIVANGKGILAADES*36VGT*39MGNRLQRIKVENTEENRRQFR ELLFTVDSSVSQSIGGVILFHETLYQKDGQGKLFRDILKEKGIVVGIKLDQGVAPLAGT*119NKETTVQGLDGLS*132ERCAQYKKDGADFGKWRAVLKIDNQCPSHLAIQENANTLARYASICQQ NGLVPIVEPEVIPDGSHDMEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLS*272GGMS*276EEDATLNLNAINLCPLPKPWKLS*299F S*301YGRALQAS*309ALAAWGGKAENKKTTQEAFMKRALANSQAAKGQYVHMGSSGSASTQSLFTA SYTY
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments In mammals AldOB is expressed in liver.Veretebrates have 3 isozymes,aldolase A(ALDOA),B (ALDOB), and C (ALDOC)
Bibliography 1.He X, Li M, Yu H, Liu G, Wang N, Yin C, Tu Q, Narla G, Tao Y, Cheng S, Yin H. Loss of hepatic aldolase B activates Akt and promotes hepatocellular carcinogenesis by destabilizing the Aldob/Akt/PP2A protein complex. PLoS Biol. 2020 Dec 4;18(12):e3000803. doi: 10.1371/journal.pbio.3000803. PMID: 33275593; PMCID: PMC7744066.