Search by BoMiProt ID - Bomi5837


Primary Information

BoMiProt ID Bomi5837
Protein Name Forkhead box protein P1
Organism Bos taurus
Uniprot IdA4IFD2
Milk Fractionwhey
Ref Sequence Id NP_001077158.1
Aminoacid Length 674
Molecular Weight 75121
Fasta Sequence https://www.uniprot.org/uniprot/A4IFD2.fasta
Gene Name FOXP1
Gene Id 515903
Protein Existence Status reviewed

Secondary Information

Protein Function It acts as a transcriptional repressor. It can function along with CTBP1 to repress transcription. It also plays an important role in the specification and differentiation of lung epithelial cells.
Biochemical Properties Forms homodimers and heterodimers with FOXP2 and FOXP4. Dimerization is required for DNA-binding.It is a winged-helix DNA-binding transcription factor, belongs to subfamily P of the forkhead box transcription factor family.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4IFD2|FOXP1_BOVIN Forkhead box protein P1 OS=Bos taurus OX=9913 GN=FOXP1 PE=2 SV=1 MMQESGTETKSNGSAIQNGSSGGNHLLECGSLREGRSNGETPAVDVGTADLAHVQQQQQA LQVARQLLLQQQQQQQVSGLKS*82PKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVL SPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQLLQQHAGKQPKEQQQVATQQLAFQ QQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLTQGMIPTELQQLWKEVTSAHTTE ETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPL YGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQLAKDKERL QAMMTHLHVKSTEPKTAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPITPATQGPS VITTTSMHTVGPIRRRYSDKYNVPISSDIAQNQEFYKNAEVRPPFTYASLIRQAILESPE KQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQK RRPQKISGNPSLIKNMQTSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIR EELNGAMEHTNSNESDSSPGRSPLQAVHPVHVKEEPLDPEEAEGPLSLVT*650TANHS*655PDFDH DRDYEDEPVNEDME
Predicted Disorder Regions 8-28, 611-618, 648-674
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Liu, X. M., Du, S. L., Miao, R., Wang, L. F., & Zhong, J. C. (2022). Targeting the forkhead box protein P1 pathway as a novel therapeutic approach for cardiovascular diseases. Heart failure reviews, 27(1), 345–355. https://doi.org/10.1007/s10741-020-09992-2