Search by BoMiProt ID - Bomi5836


Primary Information

BoMiProt ID Bomi5836
Protein Name Forkhead box protein O1/Forkhead box protein O1A/Forkhead in rhabdomyosarcoma
Organism Bos taurus
Uniprot IdE1BPQ1
Milk Fractionwhey
Aminoacid Length 624
Molecular Weight 66356
Fasta Sequence https://www.uniprot.org/uniprot/E1BPQ1.fasta
Gene Name FOXO1/FOXO1A
Protein Existence Status reviewed

Secondary Information

Protein Function Transcription factor that is the main target of insulin signaling and regulates metabolic homeostasis in response to oxidative stress. Binds to the insulin response element (IRE) with consensus sequence 5'-TT[G/A]TTTTG-3' and the related Daf-16 family binding element (DBE) with consensus sequence 5'-TT[G/A]TTTAC-3'
PTMs Acetylation, Methylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BPQ1|FOXO1_BOVIN Forkhead box protein O1 OS=Bos taurus OX=9913 GN=FOXO1 PE=3 SV=2 MAEAPQVVEIDPDFEPLPRPRSCT*24WPLPRPEFSQSNSATSSPAPSGGAAANPDGAAGLPS ASAAAVNADFMSNLSLLEESGDFQQAPGSVAAAAPLSQHPPVPPAAAAAAAGGQLAGQPR KSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWK NS*182IRHNLS*188LHSKFIRVQNEGTGKS*204S*205WWMLNPEGGKSGKS*219PRRRAAS*226MDNNSKFAKSRGRAAKKKASLQSGQEGAGDS*257PGSQFSKWPAS*268PGSHSNDDFDNWSTFRPRTSS*289NAS*292TIS*295GRLS*299PIMT*303EQDDLGDGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPTPNYQKYTYGQSSMSPLPQMPMQTLQDNKSSYG GMSQYCAPGLLKELLTSDSPPHNDIMTPVDPGVAQANSRVLGQSVLMGPNSVMPAYGGQA SHNKMMTPSSHTHPGHAQSTSAVNGRALPHAVNTMPHTSGMNRLAPVKTALQVPLAHPMQ MSALGGYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFN FDNVLPNQSFPHSVKTTTHSWVSG
Predicted Disorder Regions 13-40, 60-92, 267-290, 383-399, 611-622
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation by NLK promotes nuclear export and inhibits the transcriptional activity. In response to growth factors, phosphorylation on Thr-24, Ser-226 and Ser-292 by PKB/AKT1 promotes nuclear export and inactivation of transactivational activity. Methylation inhibits AKT1-mediated phosphorylation at Ser-226 and is increased by oxidative stress.Acetylation at Lys-232 and Lys-244 are necessary for autophagic cell death induction.
Bibliography Zimin, A. V., Delcher, A. L., Florea, L., Kelley, D. R., Schatz, M. C., Puiu, D., Hanrahan, F., Pertea, G., Van Tassell, C. P., Sonstegard, T. S., Marçais, G., Roberts, M., Subramanian, P., Yorke, J. A., & Salzberg, S. L. (2009). A whole-genome assembly of the domestic cow, Bos taurus. Genome biology, 10(4), R42. https://doi.org/10.1186/gb-2009-10-4-r42