Search by BoMiProt ID - Bomi5817


Primary Information

BoMiProt ID Bomi5817
Protein Name Follitropin subunit beta/Follicle-stimulating hormone beta subunit/Follitropin beta chain
Organism Bos taurus
Uniprot IdP04837
Milk FractionExosomes
Ref Sequence Id NP_776485.1
Aminoacid Length 129
Molecular Weight 14713
Fasta Sequence https://www.uniprot.org/uniprot/P04837.fasta
Gene Name FSHB
Gene Id 281171
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells adenohypophysis
Protein Function FSHβ may promote BMP9-induced activation of BMP/Smad signaling through a FSH/FSH receptor (FSHR)/cAMP dependent pathway.
Biochemical Properties FSH beta-subunit has multiple binding regions important for specific recognition by its receptor.N-terminus residues 9-30, in the extracellular domain of the follicle-stimulating hormone (FSH) receptor capable of binding FSH, but not luteinizing hormone (LH) or thyroid-stimulating hormone (TSH).The bullfrog FSH beta-subunit has approximately 60% sequence identity with that of mammals and 40% with the fish gonadotropin beta-subunit. 
PTMs Disulfide bond formation,N-linked glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P04837|FSHB_BOVIN Follitropin subunit beta OS=Bos taurus OX=9913 GN=FSHB PE=2 SV=1 MKSVQFCFLFCCWRAICCRSCELTN*25ITITVEKEECGFCISIN*42TTWCAGYCYTRDLVYRDP ARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATECHCSKCDSDSTDCTVRGLGPS YCSFREIKE
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Hayashi T, Hanaoka Y, Hayashi H. The complete amino acid sequence of the follitropin beta-subunit of the bullfrog, Rana catesbeiana. Gen Comp Endocrinol. 1992 Oct;88(1):144-50. doi: 10.1016/0016-6480(92)90203-v. PMID: 1426958. 2.Hayashi T, Hanaoka Y, Hayashi H. The complete amino acid sequence of the follitropin beta-subunit of the bullfrog, Rana catesbeiana. Gen Comp Endocrinol. 1992 Oct;88(1):144-50. doi: 10.1016/0016-6480(92)90203-v. PMID: 1426958. 3.Su XY, Zou X, Chen QZ, Zeng YH, Shao Y, He BC, Liu H. Follicle-Stimulating Hormone β-Subunit Potentiates Bone Morphogenetic Protein 9-Induced Osteogenic Differentiation in Mouse Embryonic Fibroblasts. J Cell Biochem. 2017 Jul;118(7):1792-1802. doi: 10.1002/jcb.25849. Epub 2017 Mar 17. PMID: 27996168.